Overview

  • Product nameAnti-PSMB10 antibody
    See all PSMB10 primary antibodies
  • Description
    Rabbit polyclonal to PSMB10
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human PSMB10 aa 144-193 (internal sequence).
    Sequence:

    LTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGL


    Database link: P40306

  • Positive control
    • Placenta lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab94623 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionThe proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides.
  • Sequence similaritiesBelongs to the peptidase T1B family.
  • Developmental stageHighly expressed in immature dendritic cells (at protein level).
  • Post-translational
    modifications
    Autocleaved. The resulting N-terminal Thr residue of the mature subunit is responsible for the nucleophile proteolytic activity.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • beta2i antibody
    • FLJ00366 antibody
    • LMP10 antibody
    • Low molecular mass protein 10 antibody
    • Macropain subunit MECl 1 antibody
    • Macropain subunit MECl-1 antibody
    • MECL1 antibody
    • MGC1665 antibody
    • Multicatalytic endopeptidase complex subunit MECl 1 antibody
    • Multicatalytic endopeptidase complex subunit MECl-1 antibody
    • OTTHUMP00000174858 antibody
    • Proteasome (prosome macropain) subunit beta type 10 antibody
    • Proteasome beta 10 subunit antibody
    • Proteasome catalytic subunit 2i antibody
    • Proteasome MECl 1 antibody
    • Proteasome MECl-1 antibody
    • Proteasome subunit beta 2i antibody
    • Proteasome subunit beta 7i antibody
    • Proteasome subunit beta type 10 antibody
    • Proteasome subunit beta type-10 antibody
    • Proteasome subunit beta-2i antibody
    • Proteasome subunit MECL1 antibody
    • PSB10_HUMAN antibody
    • PSMB 10 antibody
    • Psmb10 antibody
    see all

Anti-PSMB10 antibody images

  • Anti-PSMB10 antibody (ab94623) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human placenta lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 29 kDa

References for Anti-PSMB10 antibody (ab94623)

ab94623 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94623.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"