Overview

  • Product name
  • Description
    Mouse polyclonal to PSMB5
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human PSMB5 aa 1-263.
    Sequence:

    MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPE EPGIEMLHGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYL LGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYK GMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDR GYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDN VADLHEKYSGSTP


    Database link: P28074

  • Positive control
    • PSMB5 transfected 293T cell line lysate. HeLa cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    pH: 7.20
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab167341 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function
    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This unit is responsible of the chymotrypsin-like activity of the proteasome and is one of the principal target of the proteasome inhibitor bortezomib. May catalyze basal processing of intracellular antigens. Plays a role in the protection against oxidative damage throught the Nrf2-ARE pathway.
  • Sequence similarities
    Belongs to the peptidase T1B family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZp459C139 antibody
    • EC 3.4.25.1 antibody
    • LMPX antibody
    • Macropain epsilon chain antibody
    • MB1 antibody
    • MGC104214 antibody
    • MGC118075 antibody
    • MGC134464 antibody
    • Multicatalytic endopeptidase complex epsilon chain antibody
    • Proteasome (prosome, macropain) subunit, beta type, 5 antibody
    • Proteasome beta 5 subunit antibody
    • Proteasome catalytic subunit 3 antibody
    • Proteasome chain 6 antibody
    • Proteasome epsilon chain antibody
    • Proteasome subunit beta type-5 antibody
    • Proteasome subunit MB1 antibody
    • Proteasome subunit X antibody
    • Proteasome subunit, beta type, 5 antibody
    • Proteasome subunit, beta-5 antibody
    • PSB5_HUMAN antibody
    • PSMB5 antibody
    • PSX large multifunctional protease X antibody
    • X antibody
    see all

Images

  • All lanes : Anti-PSMB5 antibody (ab167341) at 1 µg/ml

    Lane 1 : PSMB5 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 28 kDa

  • Immunofluorescent analysis of HeLa cells labeling PSMB5 with ab167341 at 10 µg/ml.

References

ab167341 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167341.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up