Overview

  • Product nameAnti-PSMD9 antibody
    See all PSMD9 primary antibodies
  • Description
    Mouse monoclonal to PSMD9
  • Tested applicationsSuitable for: WB, ICC/IF, Flow Cytmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein (proprietary-tag) corresponding to Human PSMD9 aa 1-223.
    Sequence:

    MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGI GMNEPLVDCEGYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQL HARDKEKQARDMAEAHKEAMSRKLGQSESQGPPRAFAKVNSISPGSPASI AGLQVDDEIVEFGSVNTQNFQSLHNIGSVVQHSEGKPLNVTVIRRGEKHQ LRLVPTRWAGKGLLGCNIIPLQR


    Database link: O00233

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    PBS, pH 7.2
  • Concentration information loading...
  • PurityProtein G purified
  • ClonalityMonoclonal
  • IsotypeIgG1
  • Light chain typekappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab58115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 25 kDa.
ICC/IF Use a concentration of 5 µg/ml.
Flow Cyt Use 1µg for 106 cells. ab170190-Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

Target

  • FunctionActs as a chaperone during the assembly of the 26S proteasome, specifically of the base subcomplex of the PA700/19S regulatory complex (RC). During the base subcomplex assembly is part of an intermediate PSMD9:PSMC6:PSMC3 module, also known as modulator trimer complex; PSMD9 is released during the further base assembly process.
  • Tissue specificityExpressed in all tissues tested, highly expressed in liver and kidney.
  • Sequence similaritiesBelongs to the proteasome subunit p27 family.
    Contains 1 PDZ (DHR) domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • 26S proteasome non ATPase regulatory subunit 9 antibody
    • 26S proteasome non-ATPase regulatory subunit 9 antibody
    • 26S proteasome regulatory subunit p27 antibody
    • Homolog of rat Bridge 1 antibody
    • MGC8644 antibody
    • p27 antibody
    • Proteasome (prosome macropain) 26S subunit non ATPase 9 antibody
    • Proteasome 26S non ATPase regulatory subunit 9 antibody
    • Proteasome 26S subunit non ATPase 9 antibody
    • PSMD 9 antibody
    • Psmd9 antibody
    • PSMD9_HUMAN antibody
    • Rpn4 antibody
    see all

Anti-PSMD9 antibody images



  • Predicted band size : 25 kDa
    26S Proteasome antibody (ab58115) at 1ug/lane + HepG2 cell lysate at 25ug/lane.
  • ICC/IF image of ab58115 stained HeLa cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab58115, 5µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • Overlay histogram showing HEK293 cells stained with ab58115 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab58115, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HEK293 cells fixed with 4% paraformaldehyde (10 min)/permeabilized with 0.1% PBS-Tween for 20 min used under the same conditions.

References for Anti-PSMD9 antibody (ab58115)

This product has been referenced in:
  • Cone AC  et al. Protein kinase Cd-mediated phosphorylation of Connexin43 gap junction channels causes movement within gap junctions followed by vesicle internalization and protein degradation. J Biol Chem 289:8781-98 (2014). ICC/IF ; African Green Monkey . Read more (PubMed: 24500718) »
  • Singer H  et al. NLRP7 inter-domain interactions: the NACHT-associated domain is the physical mediator for oligomeric assembly. Mol Hum Reprod 20:990-1001 (2014). Read more (PubMed: 25082979) »

See all 2 Publications for this product

Product Wall

Abcam guarantees this product to work in the species/application used in this Abreview.
Application Western blot
Sample Human Cell lysate - whole cell (HepaRG, HepG2)
Loading amount 25 µg
Specification HepaRG, HepG2
Gel Running Conditions Reduced Denaturing
Blocking step Milk as blocking agent for 16 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: RT°C
Username

Abcam user community

Verified customer

Submitted Apr 02 2013

Abcam guarantees this product to work in the species/application used in this Abreview.
Application Immunocytochemistry/ Immunofluorescence
Sample Human Cell (HepaRG)
Specification HepaRG
Fixative Formaldehyde
Permeabilization Yes - 0.2% Triton X-100
Blocking step Milk as blocking agent for 30 minute(s) · Concentration: 1% · Temperature: RT°C
Username

Abcam user community

Verified customer

Submitted Apr 02 2013

We are very interested in this. Please do let us know if your manuscript gets published since we are very keen to know how our products have worked for our customers.
Good luck with the rest of your manscript!

Thank you for your inquiry.
Unfortunately, the epitope for this antibody has not been mapped and so we do not know what the actual antigen for this antibody is.
We aim to provide as much information as possible to our customers, so I am sorry...

Read More

Vielen Dank für Ihren Anruf und für Ihr Interesse an unseren Produkten.

Ich kann bestätigen, dass das Immunogen von ab58115 eine 89% Homologie mit Schwein (Sus scrofa) aufweist und wir deshalb mit einer Kreuzreaktion des Antikörpers rechnen ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"