Overview

  • Product nameAnti-PSMG1 antibody
    See all PSMG1 primary antibodies
  • Description
    Rabbit polyclonal to PSMG1
  • Tested applicationsSuitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal region amino acids 239-288 (

    VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT

    ) of Human PSMG1 (NP_003711)

  • Positive control
    • Fetal heart lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab83527 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/62500.

WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevancePSMG1 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization. There are two named isoforms.
  • Cellular localizationCytoplasm. Endoplasmic reticulum.
  • Database links
  • Alternative names
    • AW552102 antibody
    • c21 LRP antibody
    • C21LRP antibody
    • Chromosome 21 leucine rich protein antibody
    • Down syndrome critical region gene 2 antibody
    • Down syndrome critical region protein 2 antibody
    • Down syndrome critical region protein 2 homolog antibody
    • DSCR2 antibody
    • leucine rich protein C21 LRP antibody
    • LRPC21 antibody
    • PAC-1 antibody
    • PAC1 antibody
    • proteasome (prosome, macropain) assembly chaperone 1 antibody
    • proteasome assembling chaperone 1 antibody
    • Proteasome assembly chaperone 1 antibody
    see all

Anti-PSMG1 antibody images

  • Anti-PSMG1 antibody (ab83527) at 1 µg/ml (in 5% skim milk/ PBS) + Human fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 33 kDa
    Observed band size : 29 kDa (why is the actual band size different from the predicted?)

References for Anti-PSMG1 antibody (ab83527)

ab83527 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83527.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"