Overview

  • Product name
  • Description
    Rabbit polyclonal to PSMG2
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human PSMG2 aa 14-89.
    Sequence:

    GFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYAT TEGNSTELSINAEVYSLPSRKLVALQ


    Database link: Q969U7

  • Positive control
    • Human kidney tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab184826 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG1. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.
  • Tissue specificity
    Widely expressed with highest levels in lung, brain and colon. Moderately expressed in muscle, stomach, spleen and heart. Weakly expressed in small intestine, pancreas and liver. Highly expressed in hepatocellular carcinomas with low levels in surrounding liver tissue.
  • Sequence similarities
    Belongs to the PSMG2 family.
  • Post-translational
    modifications
    Degraded by the proteasome upon completion of 20S proteasome maturation.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD40 ligand activated specific transcript 3 antibody
    • CLAST3 antibody
    • HCCA3 antibody
    • Hepatocellular carcinoma susceptibility protein antibody
    • Hepatocellular carcinoma-susceptibility protein 3 antibody
    • HSPC260 antibody
    • HsT1707 antibody
    • Likely ortholog of mouse CD40 ligand activated specific transcript 3 antibody
    • MDS003 antibody
    • PAC-2 antibody
    • PAC2 antibody
    • proteasome (prosome, macropain) assembly chaperone 2 antibody
    • Proteasome assembly chaperone 2 antibody
    • psmG2 antibody
    • PSMG2_HUMAN antibody
    • TNFSF5IP1 antibody
    • Tumor necrosis factor superfamily member 5-induced protein 1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling PSMG2 with ab184826 at 1/200 dilution.

References

ab184826 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184826.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up