
  • Product name
    Anti-PSTK antibody
  • Description
    Rabbit polyclonal to PSTK
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 144 -193 (RPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQ R) of Human PSTK (NP_699167)

  • Positive control
    • THP-1 cell lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab89979 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 39 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Relevance
    Specifically phosphorylates seryl-tRNA(Sec) to O-phosphoseryl-tRNA(Sec), an activated intermediate for selenocysteine biosynthesis.
  • Database links
  • Alternative names
    • C10orf89 antibody
    • L-seryl-tRNA(Sec) kinase antibody
    • MGC35392 antibody
    • O-phosphoseryl-tRNA(Sec) kinase antibody
    • phosphoseryl-tRNA kinase antibody
    see all

Anti-PSTK antibody images

  • Anti-PSTK antibody (ab89979) at 1 µg/ml + THP-1 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 39 kDa

References for Anti-PSTK antibody (ab89979)

ab89979 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab89979.
Please use the links above to contact us or submit feedback about this product.


Sign up