Overview

  • Product nameAnti-PTBP2 antibody
    See all PTBP2 primary antibodies
  • Description
    Rabbit polyclonal to PTBP2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 108-157 (

    ITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQ

    ) of Human PTBP2 (NP_067013).

  • Positive control
    • PANC-1 cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab94696 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionRNA-binding protein which binds to intronic polypyrimidine tracts and mediates negative regulation of exons splicing. May antagonize in a tissue-specific manner the ability of NOVA1 to activate exon selection. Beside its function in pre-mRNA splicing, plays also a role in the regulation of translation. Isoform 5 has a reduced affinity for RNA.
  • Tissue specificityMainly expressed in brain although also detected in other tissues like heart and skeletal muscle. Isoform 1 and isoform 2 are specifically expressed in neuronal tissues. Isoform 3 and isoform 4 are expressed in non-neuronal tissues. Isoform 5 and isoform 6 are truncated forms expressed in non-neuronal tissues.
  • Sequence similaritiesContains 4 RRM (RNA recognition motif) domains.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • brPTB antibody
    • FLJ34897 antibody
    • MIBP antibody
    • Neural polypyrimidine tract binding protein antibody
    • Neural polypyrimidine tract-binding protein antibody
    • Neurally enriched homolog of PTB antibody
    • Neurally-enriched homolog of PTB antibody
    • nPTB 5 antibody
    • nPTB 6 antibody
    • nPTB 7 antibody
    • nPTB 8 antibody
    • nPTB antibody
    • nPTB5 antibody
    • nPTB6 antibody
    • nPTB7 antibody
    • nPTB8 antibody
    • Polypyrimidine tract binding protein 2 antibody
    • Polypyrimidine tract-binding protein 2 antibody
    • PTB antibody
    • PTB like antibody
    • PTB like protein antibody
    • PTB-like protein antibody
    • PTBLP antibody
    • PTBP 2 antibody
    • Ptbp2 antibody
    • PTBP2_HUMAN antibody
    • Splicing regulator antibody
    see all

Anti-PTBP2 antibody images

  • Anti-PTBP2 antibody (ab94696) at 1 µg/ml + PANC-1 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 57 kDa

References for Anti-PTBP2 antibody (ab94696)

ab94696 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94696.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"