Overview

  • Product nameAnti-PTF1A antibody [4B1]
    See all PTF1A primary antibodies
  • Description
    Mouse monoclonal [4B1] to PTF1A
  • Tested applicationsSuitable for: WB, ELISA, Sandwich ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human PTF1A aa 250-328.
    Sequence:

    QAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAK VWTPEDPRKLNSKSSFNNIENEPPFEFVS


    Database link: Q7RTS3

Properties

Applications

Our Abpromise guarantee covers the use of ab57256 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml.
ELISA Use at an assay dependent concentration.
Sandwich ELISA Use at an assay dependent concentration.

Target

  • FunctionTranscriptional activator. Binds to the E-box consensus sequence 5'-CANNTG-3'. Plays an important role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. May be involved in the maintenance of exocrine pancreas-specific gene expression including ELA1 and amylase. Required for the formation of pancreatic acinar and ductal cells (By similarity). Plays an important role in cerebellar development.
  • Tissue specificityPancreas-specific (at protein level). Loss of expression is seen in ductal type pancreas cancers.
  • Involvement in diseaseDefects in PTF1A are the cause of diabetes mellitus and cerebellar hypoplasia/agenesis (DMCH) [MIM:609069].
  • Sequence similaritiesContains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localizationNucleus. Cytoplasm. In chronic pancreatitis associated with pancreas cancer preferentially accumulates in the cytoplasm of acinar/ductular complexes. In the cytoplasm loses its ability to form the PTF1 complex.
  • Information by UniProt
  • Database links
  • FormPTF1A is a pancreas specific transcription factor. Mammalian studies have implicated important roles for the basic helix-loop-helix transcription factor PTF1A-p48 in the development of both exocrine and endocrine pancreas.
  • Alternative names
    • bHLH transcription factor p48 antibody
    • bHLHa29 antibody
    • Class A basic helix-loop-helix protein 29 antibody
    • Class II bHLH protein PTF1A antibody
    • Exocrine pancreas specific transcription factor p48 antibody
    • p48 DNA binding subunit of transcription factor PTF1 antibody
    • p48 DNA-binding subunit of transcription factor PTF1 antibody
    • Pancreas specific transcription factor 1a antibody
    • Pancreas transcription factor 1 subunit alpha antibody
    • Pancreas-specific transcription factor 1a antibody
    • PTF 1A antibody
    • PTF1 p48 antibody
    • PTF1-p48 antibody
    • Ptf1a antibody
    • PTF1A_HUMAN antibody
    • PTF1P48 antibody
    see all

Anti-PTF1A antibody [4B1] images

  • Western blot against tagged recombinant protein immunogen using ab57256 PTF1A antibody at 1ug/ml. Predicted band size of immunogen is 34 kDa

References for Anti-PTF1A antibody [4B1] (ab57256)

ab57256 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab57256.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"