• Product nameAnti-PTGER3 antibody
    See all PTGER3 primary antibodies
  • Description
    Rabbit polyclonal to PTGER3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 360-409 (MRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV Y) of Human Prostaglandin E Receptor EP3 ((NP_942011).

  • Positive control
    • HT1080 cell lysate


Associated products


Our Abpromise guarantee covers the use of ab94496 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • FunctionReceptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems.
  • Tissue specificityExpressed in small intestine, heart, pancreas, gastric fundic mucosa, mammary artery and pulmonary vessels.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family.
  • Cellular localizationCell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • EP 3 antibody
    • EP3 antibody
    • EP3 I antibody
    • EP3 II antibody
    • EP3 III antibody
    • EP3 IV antibody
    • Ep3 prostanoid receptor antibody
    • Ep3 receptor antibody
    • EP3 subtype antibody
    • EP3e antibody
    • HGNC:9595 antibody
    • MGC141828 antibody
    • MGC141829 antibody
    • MGC27302 antibody
    • PE2R3_HUMAN antibody
    • PGE receptor EP3 subtype antibody
    • PGE2 R antibody
    • PGE2 receptor EP3 subtype antibody
    • PGE2-R antibody
    • PGE2R antibody
    • Pgerep3 antibody
    • Prostaglandin E receptor 3 (subtype EP3) antibody
    • Prostaglandin E receptor 3 antibody
    • Prostaglandin E receptor EP3 subtype 3 isoform antibody
    • Prostaglandin E2 receptor antibody
    • Prostaglandin e2 receptor ep3 antibody
    • Prostaglandin E2 receptor EP3 subtype antibody
    • Prostaglandin receptor (PGE 2) antibody
    • Prostaglandin receptor 3, EP3, subtype antibody
    • Prostanoid EP3 receptor antibody
    • PTGER 3 antibody
    • Ptger3 antibody
    • Ptgerep3 antibody
    • Rep3 antibody
    • rEP3a antibody
    • rEP3b antibody
    see all

Anti-PTGER3 antibody images

  • Anti-PTGER3 antibody (ab94496) at 1 µg/ml + HT1080 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 43 kDa

References for Anti-PTGER3 antibody (ab94496)

ab94496 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us yesterday and I am sorry for the delay in getting back to you.

As discussed over the phone, I have had a look into how much peptide we would suggest using in the blocking experiment you are planning. As I mentioned ...

Read More

I now have further information to share with you in regards to the anti-PTGER3 antibody (ab94496).

I can confirm that the delay in your previous order for the peptide was due to the peptide not being available in stock. It therefore had to be ...

Read More