Overview

  • Product name
  • Description
    Mouse polyclonal to PTGES2
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Full length protein corresponding to Human PTGES2 aa 1-377. (NP_079348.1)
    Sequence:

    MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAA ARKGSPRLLGAAALALGGALGLYHTARWHLRAQDLHAERSAAQLSLSSRL QLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFSSYRKVPI LVAQEGESSQQLNDSSVIISALKTYLVSGQPLEEIITYYPAMKAVNEQGK EVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADDWLVHLISPNV YRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHRLQ DNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAF DDLMQHTHIQPWYLRVERAITEASPAH


    Database link: Q9H7Z7

  • Positive control
    • PTGES2 transfected 293T cell line.

Properties

Applications

Our Abpromise guarantee covers the use of ab172772 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 42 kDa.

Target

  • Function
    Isomerase that catalyzes the conversion of unstable intermediate of prostaglandin E2 H2 (PGH2) into the more stable prostaglandin E2 (PGE2) form. May also have transactivation activity toward IFN-gamma (IFNG), possibly via an interaction with CEBPB; however, the relevance of transcription activation activity remains unclear.
  • Tissue specificity
    Widely expressed. Expressed in the heart, including apex, inter-ventricular septum, both atria and ventricles, but not in the aorta. Also expressed in fetal heart. Detected in various regions of the brain: cerebellum; occipital, frontal and parietal lobes. Also expressed in the lymph nodes, skeletal muscle, kidney and trachea, but not in the thymus or lung. Overexpressed in colorectal cancer.
  • Pathway
    Lipid metabolism; prostaglandin biosynthesis.
  • Sequence similarities
    Belongs to the GST superfamily.
    Contains 1 glutaredoxin domain.
    Contains 1 GST C-terminal domain.
  • Cellular localization
    Golgi apparatus membrane and Cytoplasm > perinuclear region. Synthetized as a Golgi membrane-bound protein, which is further cleaved into the predominant soluble truncated form. The truncated form is cytoplasmic and is enriched in the perinuclear region.
  • Information by UniProt
  • Database links
  • Alternative names
    • C9orf15 antibody
    • FLJ14038 antibody
    • Gamma interferon activated transcriptional element binding factor 1 antibody
    • GATE binding factor 1 antibody
    • GBF 1 antibody
    • GBF1 antibody
    • Membrane associated prostaglandin E synthase 2 antibody
    • MGC11289 antibody
    • Microsomal prostaglandin E synthase 2 antibody
    • mPGES 2 antibody
    • mPGES-2 antibody
    • PGES2 antibody
    • PGES2_HUMAN antibody
    • Prostaglandin E synthase 2 antibody
    • Prostaglandin E synthase 2 truncated form antibody
    • PTGES 2 antibody
    • PTGES2 antibody
    see all

Images

  • All lanes : Anti-PTGES2 antibody (ab172772) at 1 µg/ml

    Lane 1 : PTGES2 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 42 kDa

References

ab172772 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172772.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up