Overview

  • Product nameAnti-PTK9 antibody
    See all PTK9 primary antibodies
  • Description
    Rabbit polyclonal to PTK9
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 36-85 (

    SHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWDK

    ) of Human PTK9 (NP_002813).

  • Positive control
    • Human fetal brain lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab94644 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionActin-binding protein involved in motile and morphological processes. Inhibits actin polymerization, likely by sequestering G-actin. By capping the barbed ends of filaments, it also regulates motility. Seems to play an important role in clathrin-mediated endocytosis and distribution of endocytic organelles.
  • Tissue specificityExpressed at high levels in the colon, testis, ovary, prostate and lung. Expressed at lower levels in the brain, bladder and heart. Not detected in liver.
  • Sequence similaritiesBelongs to the actin-binding proteins ADF family. Twinfilin subfamily.
    Contains 2 ADF-H domains.
  • Post-translational
    modifications
    Phosphorylated on serine and threonine residues.
  • Cellular localizationCytoplasm. Cytoplasm > cytoskeleton. Diffuse cytoplasmic localization with perinuclear and G-actin-rich cortical actin structures sublocalization. Also found at membrane ruffles and cell-cell contacts.
  • Information by UniProt
  • Database links
  • Alternative names
    • A6 antibody
    • A6 protein tyrosine kinase antibody
    • MGC105817 antibody
    • MGC23788 antibody
    • MGC41876 antibody
    • Protein A6 antibody
    • Protein tyrosine kinase 9 antibody
    • PTK9 antibody
    • PTK9 protein tyrosine kinase 9 antibody
    • TWF 1 antibody
    • twf1 antibody
    • TWF1_HUMAN antibody
    • Twinfilin 1 antibody
    • Twinfilin actin binding protein, homolog 1 antibody
    • Twinfilin antibody
    • Twinfilin, actin-binding protein, homolog 1 (Drosophila) antibody
    • Twinfilin, Drosophila, homolog of, 1 antibody
    • Twinfilin-1 antibody
    see all

Anti-PTK9 antibody images

  • Anti-PTK9 antibody (ab94644) at 1 µg/ml + Human fetal brain lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 50000

    Predicted band size : 40 kDa

References for Anti-PTK9 antibody (ab94644)

ab94644 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94644.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"