Overview

  • Product nameAnti-PTOV1 antibody
    See all PTOV1 primary antibodies
  • Description
    Rabbit polyclonal to PTOV1
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human PTOV1 aa 109-158 (N terminal).
    Sequence:

    DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRN


    Database link: Q86YD1

  • Positive control
    • Jurkat cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab81173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100.
WB Use a concentration of 1 µg/ml. Detects a band of approximately 47 kDa (predicted molecular weight: 47 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevancePTOV1 belongs to the Mediator complex subunit 25 family, PTOV1 subfamily. It may activate transcription and is required for nuclear translocation of FLOT1. PTOV1 promotes cell proliferation. There are three named isoforms.
  • Cellular localizationCell membrane. Cytoplasm, perinuclear region. Nucleus. Translocates from the cytoplasm to the nucleus at the onset of S-phase. Also localizes to lipid rafts.
  • Database links
  • Alternative names
    • ACID2 antibody
    • Activator interaction domain containing protein 2 antibody
    • Gcap3 antibody
    • prostate tumor overexpressed 1 antibody
    • Prostate tumor overexpressed gene 1 antibody
    • PTOV 1 antibody
    see all

Anti-PTOV1 antibody images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human pineal tissue labelling PTOV1 with ab81173 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as the secondary antibody. Positive staining shwon in the cytoplasm and membrane of cell bodies and processes of pinealocytes and processes of intersticial cells. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - PTOV1. Right - Merge.
  • Anti-PTOV1 antibody (ab81173) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 47 kDa
    Observed band size : 47 kDa
    Additional bands at : 90 kDa. We are unsure as to the identity of these extra bands.
    Gel concentration 12%

References for Anti-PTOV1 antibody (ab81173)

This product has been referenced in:
  • Youn HS  et al. PTOV1 antagonizes MED25 in RAR transcriptional activation. Biochem Biophys Res Commun 404:239-44 (2011). WB ; Human . Read more (PubMed: 21110951) »

See 1 Publication for this product

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"