Overview

  • Product name
  • Description
    Rabbit polyclonal to PTP kappa
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PTP kappa aa 794-852.
    Sequence:

    MTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAESSRL LDVPRYLCE


    Database link: Q15262

  • Positive control
    • Human stomach tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab185370 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Regulation of processes involving cell contact and adhesion such as growth control, tumor invasion, and metastasis. Forms complexes with beta-catenin and gamma-catenin/plakoglobin. Beta-catenin may be a substrate for the catalytic activity of PTP-kappa.
  • Tissue specificity
    High levels in lung, brain and colon; less in liver, pancreas, stomach, kidney, placenta and mammary carcinoma.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Receptor class 2B subfamily.
    Contains 4 fibronectin type-III domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 MAM domain.
    Contains 2 tyrosine-protein phosphatase domains.
  • Post-translational
    modifications
    This protein undergoes proteolytic processing.
  • Cellular localization
    Cell junction > adherens junction. Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • dJ480J14.2.1 antibody
    • DKFZp686C2268 antibody
    • DKFZp779N1045 antibody
    • OTTHUMP00000017180 antibody
    • OTTHUMP00000017181 antibody
    • OTTHUMP00000017182 antibody
    • OTTHUMP00000017187 antibody
    • OTTHUMP00000040306 antibody
    • Protein tyrosine phosphatase kappa antibody
    • Protein tyrosine phosphatase kappa precursor antibody
    • Protein tyrosine phosphatase receptor type K antibody
    • Protein tyrosine phosphatase receptor type kappa antibody
    • Protein-tyrosine phosphatase kappa antibody
    • PTPK antibody
    • PTPkappa antibody
    • Ptprk antibody
    • PTPRK_HUMAN antibody
    • R PTP kappa antibody
    • R-PTP-kappa antibody
    • Receptor type tyrosine protein phosphatase kappa antibody
    • Receptor-type tyrosine-protein phosphatase kappa antibody
    see all

Images

  • Immunohistochemistry analysis of Human stomach tissue labeling PTP kappa with ab185370 at 1/500 dilution.

References

ab185370 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185370.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up