Overview

  • Product name
  • Description
    Rabbit polyclonal to PTP1B
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human, African green monkey
  • Immunogen

    Synthetic peptide within Human PTP1B aa 16-65. The exact sequence is proprietary. (NP_002818.1).
    Sequence:

    WAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDND


    Database link: P18031

  • Positive control
    • Human kidney tissue; Extracts from COS7 cells, treated with UV 30'.

Properties

Applications

Our Abpromise guarantee covers the use of ab189179 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 50 kDa.
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

  • Function
    May play an important role in CKII- and p60c-src-induced signal transduction cascades.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Post-translational
    modifications
    Oxidized on Cys-215; the Cys-SOH formed in response to redox signaling reacts with the alpha-amido of the following residue to form a 4-amino-3-isothiazolidinone serine cross-link, triggering a conformational change that inhibits substrate binding and activity. The active site can be restored by reduction.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • PTP1B antibody
    • Non receptor tyrosine phosphatase 1 antibody
    • Protein phosphotyrosylphosphatase 1B antibody
    • Protein tyrosine phosphatase 1B antibody
    • Protein tyrosine phosphatase non receptor type 1 antibody
    • Protein tyrosine phosphatase placental antibody
    • Protein-tyrosine phosphatase 1B antibody
    • PTN1_HUMAN antibody
    • PTP 1B antibody
    • PTP-1B antibody
    • PTPN 1 antibody
    • PTPN1 antibody
    • Tyrosine protein phosphatase non receptor type 1 antibody
    • Tyrosine-protein phosphatase non-receptor type 1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human kidney tissue labeling PTP1B with ab189179 at 10 µg/ml.

  • All lanes : Anti-PTP1B antibody (ab189179) at 1/500 dilution

    Lane 1 : Extracts from COS7 cells, treated with UV 30'
    Lane 2 : Extracts from COS7 cells, treated with UV 30' with immunizing peptide

    Predicted band size: 50 kDa

References

This product has been referenced in:
  • Garner KL  et al. Enhanced insulin receptor, but not PI3K, signalling protects podocytes from ER stress. Sci Rep 8:3902 (2018). Read more (PubMed: 29500363) »
  • Borges Bde C  et al. Protein tyrosine phosphatase-1B contributes to LPS-induced leptin resistance in male rats. Am J Physiol Endocrinol Metab 308:E40-50 (2015). Read more (PubMed: 25352433) »

See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189179.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up