Overview

  • Product name
    Anti-PTPRQ antibody
  • Description
    Rabbit polyclonal to PTPRQ
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human PTPRQ aa 1605-1701.
    Sequence:

    AVITGPTCYLIDVKSVDNDEFNISFIKSNEENKTIEIKDLEIFTRYSVVI TAFTGNISAAYVEGKSSAEMIVTTLESAPKDPPNNMTFQKIPDEVTK


    Database link: Q9UMZ3

  • Positive control
    • Human kidney tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185336 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance
    PTPRQ belongs to the type III receptor-like protein-tyrosine phosphatase (PTPase) family. PTPRQ has low activity against phosphotyrosine, but is active against phosphatidylinositol phosphates that are involved in regulation of survival, proliferation, and subcellular architecture.
  • Database links
  • Alternative names
    • DFNB84 antibody
    • DFNB84A antibody
    • Protein tyrosine phosphatase RQ antibody
    • Protein tyrosine phosphatase, receptor type, Q antibody
    • PTPGMC1 antibody
    • R-PTP-Q antibody
    see all

Images

  • Immunohistochemistry analysis of paraffin embedded Human kidney tissue labeling PTPRQ with ab185336 at 1/50 dilution. 

References

ab185336 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185336.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up