Overview

  • Product nameAnti-PURA antibody
    See all PURA primary antibodies
  • Description
    Rabbit polyclonal to PURA
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Guinea pig, Cow, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 36-85 (

    GGGGGGGSGGGGGGAPGGLQHETQELASKRVDIQNKRFYLDVKQNAKGRF

    ) of Human PURA (NP_005850)

  • Positive control
    • HepG2 Cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab86534 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-PURA antibody images

  • Anti-PURA antibody (ab86534) at 1 µg/ml + HepG2 Cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 35 kDa
    Observed band size : 40 kDa (why is the actual band size different from the predicted?)

References for Anti-PURA antibody (ab86534)

ab86534 has not yet been referenced specifically in any publications.

Product Wall

Abreviews
Abcam has not validated the combination of species/application used in this Abreview.
Application CLIP
Sample Human Cell lysate - whole cell (HEK 293T)
Specification HEK 293T
Type iCLIP
Irradiation Energy Level (mJ/cm2): 150
Wavelength (nm): 254
Positive control hnRNP C antibody (sc-15386) bound protein A dynabeads, 0.1 mg/ml (antibody/beads)
Negative control Protein A dynabeads without antibody bound
Username

Abcam user community

Verified customer

Submitted Jun 02 2011

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"