Anti-Purine Nucleoside Phosphorylase DeoD type antibody (ab193482)

Overview

  • Product name
    Anti-Purine Nucleoside Phosphorylase DeoD type antibody
    See all Purine Nucleoside Phosphorylase DeoD type primary antibodies
  • Description
    Rabbit polyclonal to Purine Nucleoside Phosphorylase DeoD type
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli Purine Nucleoside Phosphorylase DeoD type aa 2-239.
    Sequence:

    MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFT GTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVK LRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDAR VGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTI CTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLGDKE


    Database link: P0ABP8

  • Positive control
    • WB: DH5a whole cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Protein G purified
  • Purification notes
    >95%
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab193482 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 26 kDa (predicted molecular weight: 26 kDa).
ELISA Use at an assay dependent concentration.

Target

  • Relevance
    Cleavage of guanosine or inosine to respective bases and sugar-1-phosphate molecules.
  • Database links
    • Alternative names
      • deoD antibody
      • Inosine phosphorylase antibody
      • PNP antibody
      • pup antibody
      • Purine nucleoside phosphorylase antibody
      see all

    Images

    • Anti-Purine Nucleoside Phosphorylase DeoD type antibody (ab193482) at 2 µg + DH5a whole cell lysate

      Secondary
      Goat polyclonal to Rabbit IgG at 1/10000 dilution

      Predicted band size: 26 kDa
      Observed band size: 26 kDa

    References

    ab193482 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193482.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up