Overview

  • Product name
  • Description
    Rabbit polyclonal to PX19
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PX19 aa 66-192. BC000007.
    Sequence:

    AERLFPANVAHSVYVLEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYC VNSDNSGWTEIRREAWVSSSLFGVSRAVQEFGLARFKSNVTKTMKGFEYI LAKLQGEAPSKTLVETAKEAKEKAKET


    Database link: Q9Y255

  • Positive control
    • K562 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab196275 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 25 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function
    May be important for the development of vital and immunocompetent organs.
  • Tissue specificity
    Highly expressed in fetal liver; less expressed in fetal brain, lung, and kidney. At the adult stage, expression is drastically reduced in the liver but highly expressed in the spleen, brain, lung, lymph nodes and peripheral blood leukocytes.
  • Sequence similarities
    Contains 1 PRELI/MSF1 domain.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt
  • Database links
  • Alternative names
    • 25 kDa protein of relevant evolutionary and lymphoid interest antibody
    • CGI 106 antibody
    • MGC87972 antibody
    • mitochondrial antibody
    • PRELI antibody
    • PRELI domain containing 1 antibody
    • PRELI domain containing protein 1 antibody
    • PRELI domain containing protein 1 mitochondrial antibody
    • PRELI domain-containing protein 1 antibody
    • PRELID 1 antibody
    • PRELID1 antibody
    • PRLD1_HUMAN antibody
    • Protein of relevant evolutionary and lymphoid interest antibody
    • PX 19 antibody
    • PX19 antibody
    • Px19 like protein antibody
    • Px19, chicken, homolog of antibody
    • Px19-like protein antibody
    • SBBI12 antibody
    see all

Images

  • Anti-PX19 antibody (ab196275) at 1/500 dilution + K562 cell lysate

    Predicted band size : 25 kDa

References

ab196275 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196275.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up