Overview

  • Product nameAnti-PYROXD1 antibody
    See all PYROXD1 primary antibodies
  • Description
    Rabbit polyclonal to PYROXD1
  • Tested applicationsSuitable for: ICC/IF, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence: QLATHFPSEDILLVTASPVIKAVTNFKQISKILEEFDVEEQSSTMLGKRF PNIKVIESGVKQLK SEEHCIVTEDGNQHVYKKLCLCAGAKPKLICEGN, corresponding to amino acids 28-125 of Human PYROXD1.

  • Positive control
    • Human colon tissue; RT-4 cell lysate; Human liver lysate
  • General notes


    ab122458 is mono-specific.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferpH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • Primary antibody notesab122458 is mono-specific.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122458 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Sequence similaritiesBelongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. PYROXD1 subfamily.
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZp762G094 antibody
    • FLJ22028 antibody
    • OTTHUMP00000240138 antibody
    • OTTHUMP00000240140 antibody
    • PYRD1_HUMAN antibody
    • Pyridine nucleotide disulphide oxidoreductase domain 1 antibody
    • Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1 antibody
    • PYROXD 1 antibody
    • PYROXD1 antibody
    see all

Anti-PYROXD1 antibody images

  • Immunofluorescent staining of Human cell line U-2 OS shows positivity in cytoplasm. Recommended concentration of ab122458 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • All lanes : Anti-PYROXD1 antibody (ab122458) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate
  • ab122458, at 1/50 dilution, staining PYROXD1 in paraffin-embedded Human colon tissue by Immunohistochemistry.

References for Anti-PYROXD1 antibody (ab122458)

ab122458 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122458.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"