Overview

  • Product nameAnti-QTRTD1 antibody
    See all QTRTD1 primary antibodies
  • Description
    Rabbit polyclonal to QTRTD1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 35-84 (YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKF I) of Human QTRTD1 (NP_078914).

  • Positive control
    • Human fetal heart lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab82754 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 47 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionInteracts with QTRT1 to form an active queuine tRNA-ribosyltransferase. This enzyme exchanges queuine for the guanine at the wobble position of tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr), thereby forming the hypermodified nucleoside queuosine (Q) (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).
  • PathwaytRNA modification; tRNA-queuosine biosynthesis.
  • Sequence similaritiesBelongs to the queuine tRNA-ribosyltransferase family. QTRTD1 subfamily.
  • Cellular localizationCytoplasm. Mitochondrion. May associate with the mitochondrion outer membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ12960 antibody
    • QTRD1_HUMAN antibody
    • qtrtd1 antibody
    • queuine tRNA ribosyltransferase domain containing 1 antibody
    • Queuine tRNA-ribosyltransferase domain-containing protein 1 antibody
    • Queuine tRNA-ribosyltransferase subunit qtrtd1 antibody
    see all

Anti-QTRTD1 antibody images

References for Anti-QTRTD1 antibody (ab82754)

ab82754 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82754.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"