Loading...
Products:Signal Transduction >> Signaling Pathway >> G Protein Signaling >> Small G Proteins >> Ras Family
If your product does not perform as described on this datasheet, we will refund or replace your product...
Read our guarantee »Anti-RAB27A antibody
See all RAB27A products (5) ...
Mouse monoclonal to RAB27A
WB, IHC-P, IP, IHC-FoFr, ICC/IFmore details
Reacts with
Rat, Human
Recombinant fragment: YCENPDIVLC GNKSDLEDQR VVKEEEAIAL AEKYGIPYFE TSAANGTNIS QAIEMLLDLI MKRMERCVDK SWIPEGVVRS NGHASTDQLS EEKEKGACGC , corresponding to amino acids 122-222 of Human RAB27A
YCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFE TSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRS NGHASTDQLSEEKEKGACGC
Liquid
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Preservative: None
PBS, pH 7.2
Concentration information loading...
Protein G purified
Monoclonal
IgG1
kappa
Signal Transduction >> Protein Trafficking >> Vesicle Transport >> Regulation
Signal Transduction >> Signaling Pathway >> G Protein Signaling >> Small G Proteins >> Ras Family
Our Abpromise guarantee covers the use of ab55667 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
WB: Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 25 kDa.
IHC-P: Use a concentration of 3 µg/ml.
IP: Use at an assay dependent dilution. See Abreview.
IHC-FoFr: Use at an assay dependent concentration. PubMed: 21832089
ICC/IF: 1/200.
Plays a role in cytotoxic granule exocytosis in lymphocytes. Required for both granule maturation and granule docking and priming at the immunologic synapse.
Found in all the examined tissues except in brain. Low expression was found in thymus, kidney, muscle and placenta. Detected in melanocytes, and in most tumor cell lines examined. Expressed in cytotoxic T-lymphocytes (CTL) and mast cells.
Defects in RAB27A are a cause of Griscelli syndrome type 2 (GS2) [MIM:607624]. Griscelli syndrome is a rare autosomal recessive disorder that results in pigmentary dilution of the skin and hair, the presence of large clumps of pigment in hair shafts, and an accumulation of melanosomes in melanocytes. GS2 patients also develop an uncontrolled T-lymphocyte and macrophage activation syndrome, known as hemophagocytic syndrome, leading to death in the absence of bone marrow transplantation. Neurological impairment is present in some patients, likely as a result of hemophagocytic syndrome.
Belongs to the small GTPase superfamily. Rab family.
Membrane. Melanosome. Late endosome. Lysosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV. Localizes to endosomal exocytic vesicles.
Target information above from: UniProt accessionP51159
The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RAB27A antibody (ab55667)

RAB27A antibody (ab55667) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human lymphoma. Heat induced antigen retrieval with Citrate buffer pH 6 has been performed prior to immunostaining.
Immunocytochemistry/ Immunofluorescence - RAB27A antibody (ab55667)

ab55667 staining cow Retinal Pigment Epithelium (RPE) cells by ICC/IF. Cells were PFA fixed and permeabilized in 0.5% Triton X-100 prior to blocking in 10% serum for 20 minutes at 25°C. The primary antibody was diluted 1/200 and incubated with the sample for 12 hours at 4°C. An Alexa Fluor® 546 conjugated goat anti-mouse antibody was used as the secondary. Rab27a, which localizes to the apical site of the RPE cells, is labeled with red fluorescence. Nuclei were counterstained with DAPI (blue).
This image is courtesy of an Abreview submitted by Dr Vladimir Milenkovic
Western blot - RAB27A antibody (ab55667)

All lanes : Anti-RAB27A antibody (ab55667) at 1/200 dilution
Lane 1 : whole cell lysate of HEK 293 transfected with empty pCDNA3 vector
Lane 2 : whole cell lysate of HEK 293 cells expressing Rab27a-GFP
Lysates/proteins at 20 µg per lane.
Secondary
HRP conjugated goat anti-mouse
developed using the ECL technique
Predicted band size : 25 kDa
Observed band size : 52 kDa (why is the actual band size different from the predicted?)
Exposure time : 30 minutes
Rab27a (25kDa)+GFP(27kDa)=52kDa
The blot was blocked with 5% milk for 30 minutes at 25°C and incubated with the primary antibody for 12 hours at 4°C.
This image is courtesy of an Abreview submitted by Dr Vladimir Milenkovic
Immunoprecipitation - RAB27A antibody (ab55667)

ab55667 (undiluted) was incubated with whole cell lysate of HEK 293 cells transfected with Rab27a-GFP and a Protein G matrix for 12 hours at 4°C to achieve immunoprecipitation. 20µg of lysate were present in the input.
ab55667 (diluted 1/200) was also used in the western blotting step.
Lane 1. lysate of HEK 293 cells expressing Rab27a-GFP
Lane 2. IP with ab55667
Lane 3. Not bound fraction
This image is courtesy of an Abreview submitted by Dr Vladimir Milenkovic
This product has been referenced in:
See all 2 publications for this product
Publishing research using ab55667? Please let us know so that we can cite the reference in this datasheet
Concentration of lot no. is
Concentration not available for this lot.
Find concentration of your lot:

RAB27A antibody (ab55667) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human lymphoma. Heat induced antigen retrieval with Citrate buffer pH 6 has been performed prior to immunostaining.

ab55667 staining cow Retinal Pigment Epithelium (RPE) cells by ICC/IF. Cells were PFA fixed and permeabilized in 0.5% Triton X-100 prior to blocking in 10% serum for 20 minutes at 25°C. The primary antibody was diluted 1/200 and incubated with the sample for 12 hours at 4°C. An Alexa Fluor® 546 conjugated goat anti-mouse antibody was used as the secondary. Rab27a, which localizes to the apical site of the RPE cells, is labeled with red fluorescence. Nuclei were counterstained with DAPI (blue).
This image is courtesy of an Abreview submitted by Dr Vladimir Milenkovic

Rab27a (25kDa)+GFP(27kDa)=52kDa
The blot was blocked with 5% milk for 30 minutes at 25°C and incubated with the primary antibody for 12 hours at 4°C.
This image is courtesy of an Abreview submitted by Dr Vladimir Milenkovic

ab55667 (undiluted) was incubated with whole cell lysate of HEK 293 cells transfected with Rab27a-GFP and a Protein G matrix for 12 hours at 4°C to achieve immunoprecipitation. 20µg of lysate were present in the input.
ab55667 (diluted 1/200) was also used in the western blotting step.
Lane 1. lysate of HEK 293 cells expressing Rab27a-GFP
Lane 2. IP with ab55667
Lane 3. Not bound fraction
This image is courtesy of an Abreview submitted by Dr Vladimir Milenkovic
4
Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
Call 01223 696 000 or contact us
