Overview

  • Product name
  • Description
    Mouse polyclonal to RAB11B
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Full length protein corresponding to Human RAB11B aa 1-218. Full length protein, corresponding to amino acids 1-218 of Human Rab11b (NP_004209).
    Sequence:

    MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFAT RSIQVDGKTIKAQIWDTAGQERYRRITSAYYRGAVGALLVYDIAKHLTYE NVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSF IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV PPTTDGQKPNKLQCCQNL


    Database link: Q15907

  • Positive control
    • Lysate of 293T cells transfected with Rab11b.

Properties

Applications

Our Abpromise guarantee covers the use of ab168559 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa.

Target

  • Function
    The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab plays a role in endocytic recycling, regulating apical recycling of several transmembrane proteins including cystic fibrosis transmembrane conductance regulator/CFTR, epithelial sodium channel/ENaC, potassium voltage-gated channel, and voltage-dependent L-type calcium channel. May also regulate constitutive and regulated secretion, like insulin granule exocytosis. Required for melanosome transport and release from melanocytes. Also regulates V-ATPase intracellular transport in response to extracellular acidosis.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rab family.
  • Post-translational
    modifications
    Citrullinated by PADI4.
  • Cellular localization
    Recycling endosome membrane. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane. Cytoplasmic vesicle, phagosome membrane. Recruited to phagosomes containing S.aureus.
  • Information by UniProt
  • Database links
  • Alternative names
    • GTP-binding protein ypt3 antibody
    • H YPT3 antibody
    • RAB11B antibody
    • RAB11B member RAS oncogene family antibody
    • Ras-related protein Rab-11B antibody
    • RB11B_HUMAN antibody
    • YPT3 antibody
    see all

Images

  • All lanes : Anti-RAB11B antibody (ab168559) at 1 µg/ml

    Lane 1 : Lysate of 293T cells transfected with Rab11b
    Lane 2 : Lysate of 293T cells (non-transfected)

    Lysates/proteins at 15 µg/ml per lane.

    Secondary
    All lanes : Goat anti-mouse HRP conjugated antibody at 1/2500 dilution

    Predicted band size: 24 kDa

References

ab168559 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168559.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up