Overview

  • Product nameAnti-RAB23 antibody
    See all RAB23 primary antibodies
  • Description
    Rabbit polyclonal to RAB23
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 (TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQ A) of Human RAB23 (NP_057361).

  • Positive control
    • Fetal muscle lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab98164 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 27 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Involvement in diseaseDefects in RAB23 are the cause of acrocephalopolysyndactyly type 2 (ACPS2) [MIM:201000]. A syndrome characterized by craniosynostosis, polysyndactyly, obesity, and cardiac defects.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Rab family.
  • Cellular localizationCell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZp781H0695 antibody
    • HSPC137 antibody
    • MGC8900 antibody
    • Rab 23 antibody
    • RAB family small GTP binding protein RAB 23 antibody
    • Rab23 antibody
    • RAB23, member RAS oncogene family antibody
    • RAB23_HUMAN antibody
    • Ras related protein Rab 23 antibody
    • Ras-related protein Rab-23 antibody
    see all

Anti-RAB23 antibody images

  • Anti-RAB23 antibody (ab98164) at 1 µg/ml + Fetal muscle lysate at 10 µg

    Predicted band size : 27 kDa

References for Anti-RAB23 antibody (ab98164)

ab98164 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your inquiry.

Unfortunately, we do not currently have more information about this product.

All available information is given on the datasheet.

We will update the on-line datasheet for this product as soon a...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"