Overview

  • Product nameAnti-RAB37 antibody
    See all RAB37 primary antibodies
  • Description
    Rabbit polyclonal to RAB37
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 143-192 (ERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQ A) of Human RAB37 according to NP_783865.

  • Positive control
    • RAB37 transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab105189 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-RAB37 antibody images

  • Anti-RAB37 antibody (ab105189) at 1 µg/ml + RAB37 transfected 293T cell lysate at 10 µg

    Predicted band size : 24 kDa

References for Anti-RAB37 antibody (ab105189)

ab105189 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105189.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"