
  • Product name
  • Description
    Rabbit polyclonal to RAB37
  • Host species
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 143-192 (ERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQ A) of Human RAB37 according to NP_783865.

  • Positive control
    • RAB37 transfected 293T cell lysate.



Our Abpromise guarantee covers the use of ab105189 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.



  • Anti-RAB37 antibody (ab105189) at 1 µg/ml + RAB37 transfected 293T cell lysate at 10 µg

    Predicted band size: 24 kDa

    Gel concentration: 12%


ab105189 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105189.
Please use the links above to contact us or submit feedback about this product.


Sign up