Overview

  • Product nameAnti-RAB6C antibody
    See all RAB6C primary antibodies
  • Description
    Rabbit polyclonal to RAB6C
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 118-167 (

    DVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLF

    ) of Human RAB6C (NP_115520).

  • Positive control
    • HepG2 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab113838 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-RAB6C antibody images

  • Anti-RAB6C antibody (ab113838) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Predicted band size : 28 kDa

References for Anti-RAB6C antibody (ab113838)

ab113838 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113838.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"