Overview

  • Product name
  • Description
    Rabbit polyclonal to Rabenosyn 5
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide corresponding to Human Rabenosyn 5 aa 145-194. NP_071735.2.
    Sequence:

    RAIEKSVVPWVNDQDVPFCPDCGNKFSIRNRRHHCRLCGSIMCKKCMELI LCGSIMCKKC MELI


    Database link: Q9H1KO

  • Positive control
    • Human kidney tissue; Jurkat and HUVEC cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab190008 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml.
WB 1/500 - 1/1000. Predicted molecular weight: 89 kDa.

Target

  • Function
    Rab4/Rab5 effector protein acting in early endocytic membrane fusion and membrane trafficking of recycling endosomes. Required for endosome fusion either homotypically or with clathrin coated vesicles. Plays a role in the lysosomal trafficking of CTSD/cathepsin D from the Golgi to lysosomes. Also promotes the recycling of transferrin directly from early endosomes to the plasma membrane. Binds phospholipid vesicles containing phosphatidylinositol 3-phosphate (PtdInsP3).
  • Sequence similarities
    Contains 1 C2H2-type zinc finger.
    Contains 1 FYVE-type zinc finger.
    Contains 1 UIM (ubiquitin-interacting motif) repeat.
  • Cellular localization
    Cell membrane. Early endosome membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 110 kDa protein antibody
    • FYVE finger containing Rab5 effector protein Rabenosyn 5 antibody
    • FYVE finger-containing Rab5 effector protein rabenosyn-5 antibody
    • Rabenosyn-5 antibody
    • RBNS5_HUMAN antibody
    • Zfyve20 antibody
    • zinc finger FYVE domain containing 20 antibody
    • Zinc finger FYVE domain-containing protein 20 antibody
    see all

Images

  • All lanes : Anti-Rabenosyn 5 antibody (ab190008) at 1/500 dilution

    Lane 1 : Jurkat cell lysate
    Lane 2 : HUVEC cell lysate
    Lane 3 : HUVEC cell lysate with synthesized peptide

    Predicted band size: 89 kDa

  • Immunohistochemical analysis of Formalin-Fixed, Paraffin-Embedded Human kidney tissue labeling Rabenosyn 5 with ab190008 at 10 µg/ml.

References

ab190008 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190008.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up