Overview

  • Product name
  • Description
    Rabbit polyclonal to RAI16
  • Specificity
    Detects endogenous levels of RAI16 protein.
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human RAI16 aa 1-743.
    Sequence:

    MLSRLGALLQEAVGAREPSIDLLQAFVEHWKGITHYYIESTDESTPAKKT DIPWRLKQMLDILVYEEQQQAAAGEAGPCLEYLLQHKILETLCTLGKAEY PPGMRQQVFQFFSKVLAQVQHPLLHYLSVHRPVQKLLRLGGTASGSVTEK EEVQFTTVLCSKIQQDPELLAYILEGKKIVGRKKACGEPTALPKDTTSHG DKDCSHDGAPARPQLDGESCGAQALNSHMPAETEELDGGTTESNLITSLL GLCQSKKSRVALKAQENLLLLVSMASPAAATYLVQSSACCPAIVRHLCQL YRSMPVFLDPADIATLEGISWRLPSAPSDEASFPGKEALAAFLGWFDYCD HLITEAHTVVADALAKAVAENFFVETLQPQLLHVSEQSILTSTALLTAML RQLRSPALLREAVAFLLGTDRQPEAPGDNPHTLYAHLIGHCDHLSDEISI TTLRLFEELLQKPHEGIIHSLVLRNLEGRPYVAWGSPEPESYEDTLDLEE DPYFTDSFLDSGFQTPAKPRLAPATSYDGKTAVTEIVNSFLCLVPEEAKT SAFLEETGYDTYVHDAYGLFQECSSRVASWGWPLTPTPLDPHEPERPFFE GHFLRVLFDRMSRILDQPYSLNLQVTSVLSRLALFPHPHIHEYLLDPYIS LAPGCRSLFSVLVRVIGDLMQRIQRVPQFPGKLLLVRKQLTGQAPGEQLD HQTLLQGVVVLEEFCKELAAIAFVKFPPHDPRQNVSPAPEGQV


    Database link: Q86V87

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.1% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab192370 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192370 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 82 kDa.
IHC-P Use at an assay dependent concentration.

Target

References

ab192370 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192370.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up