Overview

  • Product name
    Anti-RALA antibody [AT41D5]
    See all RALA primary antibodies
  • Description
    Mouse monoclonal [AT41D5] to RALA
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human RALA aa 1-203. (NP_005393)
    Sequence:

    MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADS YRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMES FAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWN VNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIR ERC


    Database link: P11233

  • Positive control
    • HepG2 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab175985 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 24 kDa.

Target

  • Function
    Multifuntional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. Plays a role in the early stages of cytokinesis and is required to tether the exocyst to the cytokinetic furrow. The RALA-exocyst complex regulates integrin-dependent membrane raft exocytosis and growth signaling. Key regulator of LPAR1 signaling and competes with ADRBK1 for binding to LPAR1 thus affecting the signaling properties of the receptor. Required for anchorage-independent proliferation of transformed cells.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Ras family.
  • Post-translational
    modifications
    Prenylation is essential for membrane localization. The geranylgeranylated form and the farnesylated mutant does not undergo alternative prenylation in response to geranylgeranyltransferase I inhibitors (GGTIs) and farnesyltransferase I inhibitors (FTIs).
  • Cellular localization
    Cell surface. Cell membrane. Cleavage furrow. Midbody. Prior to LPA treatment found predominantly at the cell surface and in the presence of LPA co-localizes with LPAR1 and LPAR2 in the endocytic vesicles. During early cytokinesis localizes at the cleavage furrow membrane. Colocalizes with EXOC2 at the early midbody ring and persists there till maturation of the midbody.
  • Information by UniProt
  • Database links
  • Alternative names
    • MGC48949 antibody
    • Ral a antibody
    • Ral A protein antibody
    • RAL antibody
    • RALA antibody
    • RALA_HUMAN antibody
    • Ras family small GTP binding protein RALA antibody
    • RAS like protein A antibody
    • Ras related protein RalA antibody
    • Ras-related protein Ral-A antibody
    • v ral simian leukemia viral oncogene homolog A (ras related) antibody
    • v ral simian leukemia viral oncogene homolog A antibody
    see all

Images

  • Lane 1 : Anti-RALA antibody [AT41D5] (ab175985) at 1/500 dilution
    Lane 2 : Anti-RALA antibody [AT41D5] (ab175985) at 1/1000 dilution
    Lane 3 : Anti-RALA antibody [AT41D5] (ab175985) at 1/2000 dilution

    Lane 1 : HepG2 cell lysate
    Lane 2 : HepG2 cell lysate
    Lane 3 : HepG2 cell lysate

    Lysates/proteins at 30 µg per lane.

    Developed using the ECL technique

    Predicted band size : 24 kDa

References

ab175985 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175985.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up