Overview

  • Product nameAnti-RALB antibody
    See all RALB primary antibodies
  • Description
    Rabbit polyclonal to RALB
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 107-156 (FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYV E) of Human RALB (NP_002872).

  • Positive control
    • ACHN cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab102093 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 23 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMultifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. Required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells. Plays a role in the late stages of cytokinesis and is required for the abscission of the bridge joining the sister cells emerging from mitosis. Required for suppression of apoptosis.
  • Sequence similaritiesBelongs to the small GTPase superfamily. Ras family.
  • Post-translational
    modifications
    Prenylation is essential for membrane localization. The geranylgeranylated form and the farnesylated mutant does not undergo alternative prenylation in response to geranylgeranyltransferase I inhibitors (GGTIs) and farnesyltransferase I inhibitors (FTIs).
  • Cellular localizationCell membrane. During late cytokinesis localizes at the midbody.
  • Information by UniProt
  • Database links
  • Alternative names
    • 5730472O18Rik antibody
    • dRalb antibody
    • GTP binding protein antibody
    • Ralb antibody
    • RALB_HUMAN antibody
    • RAS like protein B antibody
    • Ras related GTP binding protein B antibody
    • Ras-related protein Ral-B antibody
    • v ral simian leukemia viral oncogene homolog B (ras related GTP binding protein) antibody
    • v ral simian leukemia viral oncogene homolog B (ras related) antibody
    • V ral simian leukemia viral oncogene homolog B antibody
    see all

Anti-RALB antibody images

  • Anti-RALB antibody (ab102093) at 1 µg/ml + ACHN cell lysate at 10 µg

    Predicted band size : 23 kDa

References for Anti-RALB antibody (ab102093)

ab102093 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102093.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"