Anti-RANKL antibody (ab169966)
Key features and details
- Rabbit polyclonal to RANKL
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-RANKL antibody
See all RANKL primary antibodies -
Description
Rabbit polyclonal to RANKL -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human RANKL aa 189-297.
Sequence:HDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQL MVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEE ISIEVSNPS
Database link: BC117286 -
Positive control
- Human fetal colon tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Lyophilized:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab169966 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/100 - 1/500.
|
Notes |
---|
IHC-P
1/100 - 1/500. |
Target
-
Function
Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy. -
Tissue specificity
Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid. -
Involvement in disease
Defects in TNFSF11 are the cause of osteopetrosis autosomal recessive type 2 (OPTB2) [MIM:259710]; also known as osteoclast-poor osteopetrosis. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. The disorder occurs in two forms: a severe autosomal recessive form occurring in utero, infancy, or childhood, and a benign autosomal dominant form occurring in adolescence or adulthood. Autosomal recessive osteopetrosis is usually associated with normal or elevated amount of non-functional osteoclasts. OPTB2 is characterized by paucity of osteoclasts, suggesting a molecular defect in osteoclast development. -
Sequence similarities
Belongs to the tumor necrosis factor family. -
Post-translational
modificationsThe soluble form of isoform 1 derives from the membrane form by proteolytic processing (By similarity). The cleavage may be catalyzed by ADAM17. -
Cellular localization
Cytoplasm; Secreted and Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 8600 Human
- Entrez Gene: 21943 Mouse
- Entrez Gene: 117516 Rat
- Omim: 602642 Human
- SwissProt: O14788 Human
- SwissProt: O35235 Mouse
- SwissProt: Q9ESE2 Rat
- Unigene: 333791 Human
see all -
Alternative names
- CD254 antibody
- hRANKL2 antibody
- ODF antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (6)
ab169966 has been referenced in 6 publications.
- Kisielowski K et al. Prognostic relevance of clinicopathological factors in sporadic and syndromic odontogenic keratocysts: A comparative study. Adv Clin Exp Med 32:245-259 (2023). PubMed: 36226690
- Huang L et al. Lithium chloride promotes osteogenesis and suppresses apoptosis during orthodontic tooth movement in osteoporotic model via regulating autophagy. Bioact Mater 6:3074-3084 (2021). PubMed: 33778189
- Kisielowski K et al. Immunoexpression of RANK, RANKL and OPG in sporadic odontogenic keratocysts and their potential association with recurrence. Adv Clin Exp Med 30:301-307 (2021). PubMed: 33768738
- Jiang Y et al. Mechanosensitive Piezo1 in Periodontal Ligament Cells Promotes Alveolar Bone Remodeling During Orthodontic Tooth Movement. Front Physiol 12:767136 (2021). PubMed: 34880779
- Gao J et al. Bone marrow mesenchymal stem cells improve bone erosion in collagen-induced arthritis by inhibiting osteoclasia-related factors and differentiating into chondrocytes. Stem Cell Res Ther 11:171 (2020). PubMed: 32381074
- He XF et al. Berberine alleviates oxidative stress in rats with osteoporosis through receptor activator of NF-kB/receptor activator of NF-kB ligand/osteoprotegerin (RANK/RANKL/OPG) pathway. Bosn J Basic Med Sci 17:295-301 (2017). PubMed: 29055350