Overview

  • Product name
  • Description
    Rabbit polyclonal to RANKL
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human RANKL aa 189-297.
    Sequence:

    HDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQL MVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEE ISIEVSNPS


    Database link: BC117286

  • Positive control
    • Human fetal colon tissue.

Properties

  • Form
    Lyophilised:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary.
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab169966 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function
    Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy.
  • Tissue specificity
    Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid.
  • Involvement in disease
    Defects in TNFSF11 are the cause of osteopetrosis autosomal recessive type 2 (OPTB2) [MIM:259710]; also known as osteoclast-poor osteopetrosis. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. The disorder occurs in two forms: a severe autosomal recessive form occurring in utero, infancy, or childhood, and a benign autosomal dominant form occurring in adolescence or adulthood. Autosomal recessive osteopetrosis is usually associated with normal or elevated amount of non-functional osteoclasts. OPTB2 is characterized by paucity of osteoclasts, suggesting a molecular defect in osteoclast development.
  • Sequence similarities
    Belongs to the tumor necrosis factor family.
  • Post-translational
    modifications
    The soluble form of isoform 1 derives from the membrane form by proteolytic processing (By similarity). The cleavage may be catalyzed by ADAM17.
  • Cellular localization
    Cytoplasm; Secreted and Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD254 antibody
    • hRANKL2 antibody
    • ODF antibody
    • OPGL antibody
    • OPTB2 antibody
    • Osteoclast differentiation factor antibody
    • Osteoprotegerin ligand antibody
    • RANKL antibody
    • Receptor activator of nuclear factor kappa B ligand antibody
    • Receptor activator of nuclear factor kappa-B ligand antibody
    • sOdf antibody
    • TNF related activation induced cytokine antibody
    • TNF-related activation-induced cytokine antibody
    • TNF11_HUMAN antibody
    • TNFSF 11 antibody
    • Tnfsf11 antibody
    • TRANCE antibody
    • Tumor necrosis factor (ligand) superfamily member 11 antibody
    • Tumor necrosis factor ligand superfamily member 11 antibody
    • Tumor necrosis factor ligand superfamily member 11, soluble form antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal colon tissue labeling RANKL with ab169966 at 1/100 dilution.

References

ab169966 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169966.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up