Overview

  • Product name
  • Description
    Rabbit polyclonal to RANTES
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Horse, Guinea pig, Rhesus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human RANTES aa 24-91.
    Sequence:

    SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVC ANPEKKWVREYINSLEMS


    Database link: P13501

  • Positive control
    • Jurkat, U937 and Mouse thymus extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab189841 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 10 kDa.
IHC-P 1/50 - 1/200.

Target

  • Function
    Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils.
  • Tissue specificity
    T-cell and macrophage specific.
  • Sequence similarities
    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications
    N-terminal processed form RANTES(3-68) is produced by proteolytic cleavage, probably by DPP4, after secretion from peripheral blood leukocytes and cultured sarcoma cells.
    The identity of the O-linked saccharides at Ser-27 and Ser-28 are not reported in PubMed:1380064. They are assigned by similarity.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Beta chemokine RANTES antibody
    • Beta chemokine RANTES precursor antibody
    • C C motif chemokine 5 antibody
    • CCL 5 antibody
    • CCL5 antibody
    • CCL5_HUMAN antibody
    • Chemokine (C C motif) ligand 5 antibody
    • Chemokine CC Motif Ligand 5 antibody
    • D17S136E antibody
    • EoCP antibody
    • Eosinophil chemotactic cytokine antibody
    • MGC17164 antibody
    • RANTES(4-68) antibody
    • Regulated upon activation normally T expressed and presumably secreted antibody
    • SCYA 5 antibody
    • SCYA5 antibody
    • SIS delta antibody
    • SIS-delta antibody
    • SISd antibody
    • Small inducible cytokine A5 (RANTES) antibody
    • Small inducible cytokine A5 antibody
    • Small inducible cytokine subfamily A (Cys Cys) member 5 antibody
    • Small-inducible cytokine A5 antibody
    • T cell specific protein p288 antibody
    • T cell specific RANTES protein antibody
    • T cell-specific protein P228 antibody
    • T-cell-specific protein RANTES antibody
    • TCP 228 antibody
    • TCP228 antibody
    see all

Images

  • All lanes : Anti-RANTES antibody (ab189841) at 1/500 dilution

    Lane 1 : Jurkat cell extract
    Lane 2 : U937 cell extract
    Lane 3 : Mouse thymus extract


    Predicted band size : 10 kDa

References

ab189841 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

According to the RANTES uniprot file here (http://www.uniprot.org/uniprot/P13501) the signal peptide cleaved in mature RANTES is amino acids 1-23. The resulting cleaved form amino acids 24-91 is 7.9 kDa. According to the same uniprot file, the protein ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up