Overview

  • Product nameAnti-RASA1 antibody
    See all RASA1 primary antibodies
  • Description
    Rabbit polyclonal to RASA1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Mouse RASA1 aa 728-777 (C terminal).
    Sequence:

    SNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRT


    Database link: Q91YX7

  • Positive control
    • Mouse brain lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab113969 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 94 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionInhibitory regulator of the Ras-cyclic AMP pathway. Stimulates the GTPase of normal but not oncogenic Ras p21.
  • Tissue specificityIn placental villi, detected only in the trophoblast layer (cytotrophoblast and syncytiotrophoblast). Not detected in stromal, endothelial or Hofbauer cells (at protein level).
  • Involvement in diseaseNote=Mutations in the SH2 domain of RASA seem to be oncogenic and cause basal cell carcinomas.
    Defects in RASA1 are the cause of capillary malformation-arteriovenous malformation (CMAVM) [MIM:608354]. CMAVM is a disorder characterized by atypical capillary malformations that are multiple, small, round to oval in shape and pinkish red in color. These capillary malformations are associated with either arteriovenous malformation, arteriovenous fistula, or Parkes Weber syndrome.
    Defects in RASA1 are a cause of Parkes Weber syndrome (PKWS) [MIM:608355]. PKWS is a disorder characterized by a cutaneous flush with underlying multiple micro-arteriovenous fistulas, in association with soft tissue and skeletal hypertrophy of the affected limb.
  • Sequence similaritiesContains 1 C2 domain.
    Contains 1 PH domain.
    Contains 1 Ras-GAP domain.
    Contains 2 SH2 domains.
    Contains 1 SH3 domain.
  • Post-translational
    modifications
    The N-terminus is blocked.
  • Cellular localizationCytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • CM AVM antibody
    • CMAVM antibody
    • DKFZp434N071 antibody
    • GAP antibody
    • GTPase activating protein antibody
    • GTPase-activating protein antibody
    • OTTHUMP00000222390 antibody
    • OTTHUMP00000222391 antibody
    • OTTHUMP00000222392 antibody
    • OTTHUMP00000222393 antibody
    • p120GAP antibody
    • p120RASGAP antibody
    • PKWS antibody
    • Ras GTPase-activating protein 1 antibody
    • RAS p21 protein activator (GTPase activating protein) 1 antibody
    • Ras p21 protein activator antibody
    • RASA antibody
    • RASA1 antibody
    • RASA1_HUMAN antibody
    • RasGAP antibody
    • Triphosphatase activating protein antibody
    see all

Anti-RASA1 antibody images

  • Anti-RASA1 antibody (ab113969) at 1 µg/ml + Mouse brain lysate at 10 µg

    Predicted band size : 94 kDa
    Gel concentration: 6-18%.

References for Anti-RASA1 antibody (ab113969)

ab113969 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113969.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"