Overview

  • Product nameAnti-RASGRF1 antibody
    See all RASGRF1 primary antibodies
  • Description
    Rabbit polyclonal to RASGRF1
  • Tested applicationsSuitable for: ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human RASGRF1 aa 107-155. Also detects isoform 1 with immunogen from aa 893 to 942 (full protein lenght = 1275).
    Sequence:

    RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG


    Database link: Q13972-2

  • Positive control
    • HepG2 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab94722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/200. Use with paraformaldehyde fixed cells and permeabilise with 0.5% Triton X-100
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 145 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionPromotes the exchange of Ras-bound GDP by GTP.
  • Sequence similaritiesContains 1 DH (DBL-homology) domain.
    Contains 1 IQ domain.
    Contains 1 N-terminal Ras-GEF domain.
    Contains 2 PH domains.
    Contains 1 Ras-GEF domain.
  • DomainThe DH (DBL-homology) domain mediates interaction with RASGRF2.
  • Post-translational
    modifications
    Ubiquitinated.
  • Information by UniProt
  • Database links
  • Alternative names
    • CDC25 antibody
    • CDC25L antibody
    • GNRP antibody
    • GRF1 antibody
    • GRF55 antibody
    • Guanine nucleotide exchange factor antibody
    • Guanine nucleotide releasing factor 55 kD antibody
    • Guanine nucleotide releasing protein antibody
    • guanine nucleotide-releasing factor 1 antibody
    • Guanine nucleotide-releasing protein antibody
    • H GRF55 antibody
    • HGRF55 antibody
    • PP13187 antibody
    • Ras protein specific guanine nucleotide releasing factor 1 antibody
    • Ras specific guanine nucleotide releasing factor antibody
    • Ras specific guanine nucleotide releasing factor CDC25 homolog antibody
    • Ras specific nucleotide exchange factor CDC25 antibody
    • Ras-GRF1 antibody
    • Ras-specific guanine nucleotide-releasing factor 1 antibody
    • Ras-specific nucleotide exchange factor CDC25 antibody
    • RASGRF1 antibody
    • RGRF1_HUMAN antibody
    see all

Anti-RASGRF1 antibody images



  • Predicted band size : 145 kDa
    Western blot analysis of HepG2 cell lysate labelling RASGRF1 with ab94722 at 1.0µg/ml.
  • Anti-RASGRF1 antibody (ab94722) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 145 kDa
    Additional bands at : 55 kDa (possible isoform).
    Gel concentration 6-18%
  • Anti-RASGRF1 antibody (ab94722) at 1 µg/ml + Fetal Liver Lysate

    Predicted band size : 145 kDa
    Additional bands at : 55 kDa (possible isoform).
  • Anti-RASGRF1 antibody (ab94722) + Fetal Lung Lysate

    Predicted band size : 145 kDa
    Additional bands at : 55 kDa (possible isoform).
  • Anti-RASGRF1 antibody (ab94722) at 1 µg/ml + Fetal Heart lysate

    Predicted band size : 145 kDa
    Additional bands at : 55 kDa (possible isoform).
  • Anti-RASGRF1 antibody (ab94722) at 1 µg/ml + Fetal Brain Lysate

    Predicted band size : 145 kDa
    Additional bands at : 55 kDa (possible isoform).
  • ab94722 (1/200) staining RASGRF1 in assynchronous HeLa cells (green). Cells were fixed in paraformaldehyde, permeabilised with 0.5% Triton X100 and counterstained with DAPI in order to highlight the nucleus (red). For further experimental details please refer to Abreview.

    See Abreview

References for Anti-RASGRF1 antibody (ab94722)

ab94722 has not yet been referenced specifically in any publications.

Product Wall

Abreviews
Application Western blot
Loading amount 50 µg
Gel Running Conditions Reduced Denaturing (4-10% Tris Glycine Gradient gel)
Sample Zebra finch Tissue lysate - whole (whole brain)
Specification whole brain
Blocking step Rotiblock as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Apr 03 2014

Abcam guarantees this product to work in the species/application used in this Abreview.
Application Immunocytochemistry/ Immunofluorescence
Sample Human Cell (HeLa)
Specification HeLa
Fixative Paraformaldehyde
Permeabilization Yes - 0.5% Triton X100
Username

Dr. Kirk McManus

Verified customer

Submitted May 04 2011

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"