Anti-RASSF5 antibody - C-terminal (ab170997)

Overview

  • Product name
    Anti-RASSF5 antibody - C-terminal
    See all RASSF5 primary antibodies
  • Description
    Rabbit polyclonal to RASSF5 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human, Pig
  • Immunogen

    Synthetic peptide within Mouse RASSF5 aa 351-400 (C terminal). The exact sequence is proprietary.
    Sequence:

    SFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQK


    Database link: NP_061220

  • Positive control
    • WB: Mouse spleen tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab170997 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 47 kDa.

Target

  • Function
    Potential tumor suppressor. Seems to be involved in lymphocyte adhesion by linking RAP1A activation upon T cell receptor or chemokine stimulation to integrin activation. Isoform 2 stimulates lymphocyte polarization and the patch-like distribution of ITGAL/LFA-1, resulting in an enhanced adhesion to ICAM1. Together with RAP1A may participate in regulation of microtubule growth. The association of isoform 2 with activated RAP1A is required for directional movement of endothelial cells during wound healing. May be involved in regulation of Ras apoptotic function. The RASSF5-STK4 complex may mediate HRAS1 and KRAS induced apoptosis.
  • Tissue specificity
    Widely expressed. Frequently down-regulated in lung tumor cell lines and primary lung tumors.
  • Sequence similarities
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 Ras-associating domain.
    Contains 1 SARAH domain.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton. Isoform 2 is mainly located in the perinuclear region of unstimulated primary T cells. Upon stimulation translocates to the leading edge and colocalizes with ITGAL/LFA-1 in the peripheral zone of the immunological synapse. Isoform 2 is localized to growing microtubules in vascular endothelial cells and is dissociated from microtubules by activated RAP1A.
  • Information by UniProt
  • Database links
  • Alternative names
    • Maxp 1 antibody
    • MAXP1 antibody
    • MGC10823 antibody
    • MGC17344 antibody
    • New ras effector 1 antibody
    • NORE 1 antibody
    • NORE1 antibody
    • NORE1A antibody
    • NORE1B antibody
    • Novel Ras effector 1 antibody
    • RAP1 Binding Protein antibody
    • RAPL antibody
    • Ras association (RalGDS/AF 6) domain family 5 antibody
    • Ras association (RalGDS/AF 6) domain family member 5 antibody
    • Ras association domain containing family protein 5 antibody
    • Ras association domain-containing protein 5 antibody
    • Ras effector like protein antibody
    • RASF5_HUMAN antibody
    • RASSF 3 antibody
    • RASSF 5 antibody
    • RASSF3 antibody
    • RASSF5 antibody
    • Regulator for cell adhesion and polarization enriched in lymphoid tissue antibody
    • Regulator for cell adhesion and polarization enriched in lymphoid tissues antibody
    • Tumor suppressor RASSF3 antibody
    see all

Images

  • Anti-RASSF5 antibody - C-terminal (ab170997) at 1 µg/ml + Mouse spleen tissue lysate at 10 µg

    Predicted band size: 47 kDa

References

ab170997 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170997.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up