Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Species
      Rat
    • Sequence
      AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF
    • Amino acids
      1 to 34

Specifications

Our Abpromise guarantee covers the use of ab42344 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

  • Reconstitution
    Resuspend in 0.1% acetic acid for required concentration (vial contains 0.1 mg).

General Info

  • Alternative names
    • hPTH
    • Parathormone
    • Parathyrin
    • Parathyroid hormone
    • Parathyroid hormone 1
    • Prepro PTH
    • Preproparathyroid hormone
    • PTH
    • PTH1
    • PTH1 receptor
    • PTH1R
    • PTHR
    • PTHR1
    • PTHY_HUMAN
    see all
  • Function
    PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
  • Involvement in disease
    Defects in PTH are a cause of familial isolated hypoparathyroidism (FIH) [MIM:146200]; also called autosomal dominant hypoparathyroidism or autosomal dominant hypocalcemia. FIH is characterized by hypocalcemia and hyperphosphatemia due to inadequate secretion of parathyroid hormone. Symptoms are seizures, tetany and cramps. FIH exist both as autosomal dominant and recessive forms of hypoparathyroidism.
  • Sequence similarities
    Belongs to the parathyroid hormone family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References for Rat Parathyroid Hormone peptide (ab42344)

This product has been referenced in:

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab42344.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up