Overview

  • Product nameAnti-RAVER2 antibody
    See all RAVER2 primary antibodies
  • Description
    Rabbit polyclonal to RAVER2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Cow, Cat
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 468-517 (

    ITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYLQ

    ) of Human RAVER2 (NP_060681).

  • Positive control
    • HT1080 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab94574 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 74 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay bind single-stranded nucleic acids.
  • Sequence similaritiesContains 3 RRM (RNA recognition motif) domains.
  • Cellular localizationNucleus. Cytoplasm. May shuttle between the nucleus and the cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZp762D1011 antibody
    • FLJ10770 antibody
    • KIAA1579 antibody
    • Protein raver 2 antibody
    • Protein raver-2 antibody
    • Raver2 antibody
    • RAVR2_HUMAN antibody
    • Ribonucleoprotein PTB binding 2 antibody
    • Ribonucleoprotein PTB-binding 2 antibody
    see all

Anti-RAVER2 antibody images



  • Predicted band size : 74 kDa
    Western blot analysis of PANC1 cell lysate labeling RAVER2 with ab94574 at 1.0µg/ml


  • Predicted band size : 74 kDa
    Western blot analysis of OVCAR-3 cell lysate labeling RAVER2 with ab94574 at 1.0µg/ml
  • Anti-RAVER2 antibody (ab94574) at 1 µg/ml + HT1080 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 74 kDa

References for Anti-RAVER2 antibody (ab94574)

ab94574 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94574.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"