
  • Product nameAnti-RBM11 antibody
    See all RBM11 primary antibodies
  • Description
    Rabbit polyclonal to RBM11
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 215-264 (SLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNN R) of Human RBM11 (NP_658983).

  • Positive control
    • 721_B cell lysate



Our Abpromise guarantee covers the use of ab106336 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-RBM11 antibody images

  • Anti-RBM11 antibody (ab106336) at 1 µg/ml + 721_B cell lysate at 10 µg

    Predicted band size : 32 kDa

References for Anti-RBM11 antibody (ab106336)

ab106336 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106336.
Please use the links above to contact us or submit feedback about this product.