• Product nameAnti-RBM22 antibody
    See all RBM22 primary antibodies
  • Description
    Rabbit polyclonal to RBM22
  • Tested applicationsSuitable for: WB, IHC-P, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide (Human). Amino acid regions from which the immunogen sequence was derived, KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF .

  • Positive control
    • Jurkat cell lysate and human heart and skeletal muscle tissue.


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab59157 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.25 µg/ml. Detects a band of approximately 50 kDa (predicted molecular weight: 47 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay:1/1562500.


  • FunctionInvolved in the first step of pre-mRNA splicing. Binds directly to the internal stem-loop (ISL) domain of the U6 snRNA and to the pre-mRNA intron near the 5' splice site during the activation and catalytic phases of the spliceosome cycle. Involved in both translocations of the nuclear SLU7 to the cytoplasm and the cytosolic calcium-binding protein PDCD6 to the nucleus upon cellular stress responses.
  • Sequence similaritiesBelongs to the SLT11 family.
    Contains 1 C3H1-type zinc finger.
    Contains 1 RRM (RNA recognition motif) domain.
  • DomainThe C-terminus RRM domain and the zinc finger motif are necessary for RNA-binding.
  • Cellular localizationNucleus. Cytoplasm. Mainly located in the nucleus. Translocated from the nucleus to the cytoplasm after heat shock cell treatment. May be shuttling between the nucleus and the cytosol.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cwc2 antibody
    • FLJ10290 antibody
    • fSAP47 antibody
    • Functional spliceosome associated protein 47 antibody
    • Pre mRNA splicing factor RBM22 antibody
    • Pre-mRNA-splicing factor RBM22 antibody
    • RBM 22 antibody
    • rbm22 antibody
    • RBM22_HUMAN antibody
    • RNA binding motif protein 22 antibody
    • RNA-binding motif protein 22 antibody
    • ZC3H16 antibody
    • Zinc finger CCCH domain containing protein 16 antibody
    • Zinc finger CCCH domain-containing protein 16 antibody
    see all

Anti-RBM22 antibody images

  • Anti-RBM22 antibody (ab59157) at 0.25 µg/ml + Jurkat cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 47 kDa
    Observed band size : 50 kDa (why is the actual band size different from the predicted?)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human heart tissue labelling RBM22 with ab59157 at 4-8µg/ml. Arrows indicate positively labelled myocardial cells. Magnification: 400X.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human muscle tissue labelling RMB22 with ab59157 at 4-8µg/ml. Arrows indicate positively labelled skeletal muscle cells. Magnification: 400X.

References for Anti-RBM22 antibody (ab59157)

ab59157 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab59157.
Please use the links above to contact us or submit feedback about this product.