Overview

  • Product name
  • Description
    Rabbit polyclonal to RBM42
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 321-372,

    RPRPPRPEPPPGLMALEVPEPLGEDKKKGKPEKLKRCIRTAAGSSWEDPS

    , of Human RBM42 (NP_077297).

  • Positive control
    • HepG2 cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab102582 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 50 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    RNA binding motif protein 42 (RBM42) C-terminal domain interacts with HNRNPK C-terminla domain and RNA. RBM42 and HNRNPK are involved in the maintenance of cellular ATP levels during stress, possibly by protecting critical mRNAs. Upon stress response, RBM42 localizes with HNRNPK in cytoplasmic aggregates of stalled translational pre-initiation complexes called stress granules. There are 4 isoforms produced by alternative splicing.
  • Cellular localization
    Cytoplasmic and Nuclear
  • Database links
  • Alternative names
    • MGC10433 antibody
    • RNA binding motif protein 42 antibody
    • RNA binding protein 42 antibody

Anti-RBM42 antibody images

  • Anti-RBM42 antibody (ab102582) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Predicted band size : 50 kDa

References for Anti-RBM42 antibody (ab102582)

ab102582 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102582.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up