Overview

  • Product name
  • Description
    Rabbit polyclonal to RBP2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide conjugated to KLH, corresponding to a region within internal sequence amino acids 63-92,

    VDFTVGVEFDEYTKSLDNRHVKALVTWEGD

    , of Human RBP2

  • Positive control
    • 293 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab102840 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500. Predicted molecular weight: 16 kDa.

Target

  • Function
    Intracellular transport of retinol.
  • Tissue specificity
    Higher expression in adult small intestine and to a much lesser extent in fetal kidney.
  • Sequence similarities
    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain
    Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cellular retinol binding protein II antibody
    • Cellular retinol-binding protein II antibody
    • CRABP II antibody
    • Crbp 2 antibody
    • CRBP II antibody
    • CRBP-II antibody
    • CRBP2 antibody
    • CrbpII antibody
    • MGC159254 antibody
    • MGC159256 antibody
    • Rbp 2 antibody
    • Rbp2 antibody
    • RBPC2 antibody
    • RET2_HUMAN antibody
    • Retinol binding protein 2 antibody
    • Retinol binding protein 2 cellular antibody
    • Retinol-binding protein 2 antibody
    see all

Images

  • Anti-RBP2 antibody (ab102840) at 2 µg/ml + 293 cell lysate at 35 µg

    Predicted band size : 16 kDa

References

ab102840 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102840.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up