Overview

  • Product nameAnti-RBP2 antibody
    See all RBP2 primary antibodies
  • Description
    Rabbit polyclonal to RBP2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide conjugated to KLH, corresponding to a region within internal sequence amino acids 63-92,

    VDFTVGVEFDEYTKSLDNRHVKALVTWEGD

    , of Human RBP2

  • Positive control
    • 293 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab102840 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500. Predicted molecular weight: 16 kDa.

Target

  • FunctionIntracellular transport of retinol.
  • Tissue specificityHigher expression in adult small intestine and to a much lesser extent in fetal kidney.
  • Sequence similaritiesBelongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • DomainForms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localizationCytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cellular retinol binding protein II antibody
    • Cellular retinol-binding protein II antibody
    • CRABP II antibody
    • Crbp 2 antibody
    • CRBP II antibody
    • CRBP-II antibody
    • CRBP2 antibody
    • CrbpII antibody
    • MGC159254 antibody
    • MGC159256 antibody
    • Rbp 2 antibody
    • Rbp2 antibody
    • RBPC2 antibody
    • RET2_HUMAN antibody
    • Retinol binding protein 2 antibody
    • Retinol binding protein 2 cellular antibody
    • Retinol-binding protein 2 antibody
    see all

Anti-RBP2 antibody images

  • Anti-RBP2 antibody (ab102840) at 2 µg/ml + 293 cell lysate at 35 µg

    Predicted band size : 16 kDa

References for Anti-RBP2 antibody (ab102840)

ab102840 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102840.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"