Recombinant Arginine deiminase protein (ab119147)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP23793
    • SequenceMSVFDSKFKGIHVYSEIGELESVLVHEPGREIDYITPARLDELLFSAILE SHDARKEHKQFVAELKANDINVVELIDLVAETYDLASQEAKDKLIEEFLE DSEPVLSEEHKVVVRNFLKAKKTSRELVEIMMAGITKTDLGIEADHELIV DPMPNLYFTRDPFASVGNGVTIHYMRYKVRQRETLFSRFVFSNHPKLINT PWYYDPSLKLSIEGGDVFIYNNDTLVVGVSERTDLQTVTLLAKNIVANKE CEFKRIVAINVPKWTNLMHLDTWLTMLDKDKFLYSPIANDVFKFWDYDLV NGGAEPQPVENGLPLEGLLQSIINKKPVLIPIAGEGASQMEIERETHFDG TNYLAIRPGVVIGYSRNEKTNAALEAAGIKVLPFHGNQLSLGMGNARCMS MPLSRKDVKW
    • Molecular weight47 kDa
    • Amino acids1 to 410

Specifications

Our Abpromise guarantee covers the use of ab119147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityMeasured by its ability to induce apoptosis in Jurkat cells using a concentration of 100-150 ng/ml.
  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level< 0.100 Eu/µg
  • Purity> 95 % SDS-PAGE.
    Purity greater than 97% by SDS-PAGE gel and HPLC analyses.
  • FormLyophilised
  • Additional notes


    Arginine Deiminase (ADI) is a microbial enzyme from Mycoplasma produced in E.coli. It has high affinity to L-arginine and hydrolyzes L-arginine to citrulline and ammonia. Low concentrations of ADI have been shown to inhibit proliferation in certain cultured cells by arresting the cell cycle in G (1) and/or S phase. Higher concentrations of ADI lead to subsequent apoptosis.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.03% Sodium phosphate, 0.003% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionReconstitute in water to a concentration of 0.1-1.0 mg/ml.

General Info

  • Alternative names
    • AD
    • ADI
    • Arginine deiminase
    • Arginine dihydrolase
    • EC=3.5.3.6
    see all
  • RelevanceAmino-acid degradation; L-arginine degradation via ADI pathway; carbamoyl phosphate from L-arginine: step 1/2.
  • Cellular localizationCytoplasmic

References for Recombinant Arginine deiminase protein (ab119147)

ab119147 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your enquiry.

Reviewing the details for ab119147 Active Arginine deiminase full length protein, the datasheet gives a range between 100-150 ng/ml for induction of apoptosis in Jurkat cells. If you are determining the activity usi...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"