Recombinant Arginine deiminase protein (ab119147)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Mycoplasma arginini
    • Sequence
      MSVFDSKFKGIHVYSEIGELESVLVHEPGREIDYITPARLDELLFSAILE SHDARKEHKQFVAELKANDINVVELIDLVAETYDLASQEAKDKLIEEFLE DSEPVLSEEHKVVVRNFLKAKKTSRELVEIMMAGITKTDLGIEADHELIV DPMPNLYFTRDPFASVGNGVTIHYMRYKVRQRETLFSRFVFSNHPKLINT PWYYDPSLKLSIEGGDVFIYNNDTLVVGVSERTDLQTVTLLAKNIVANKE CEFKRIVAINVPKWTNLMHLDTWLTMLDKDKFLYSPIANDVFKFWDYDLV NGGAEPQPVENGLPLEGLLQSIINKKPVLIPIAGEGASQMEIERETHFDG TNYLAIRPGVVIGYSRNEKTNAALEAAGIKVLPFHGNQLSLGMGNARCMS MPLSRKDVKW
    • Molecular weight
      47 kDa
    • Amino acids
      1 to 410

Specifications

Our Abpromise guarantee covers the use of ab119147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its ability to induce apoptosis in Jurkat cells using a concentration of 100-150 ng/ml.
  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    > 95 % SDS-PAGE.
    Purity greater than 97% by SDS-PAGE gel and HPLC analyses.
  • Form
    Lyophilised
  • Additional notes


    Arginine Deiminase (ADI) is a microbial enzyme from Mycoplasma produced in E.coli. It has high affinity to L-arginine and hydrolyzes L-arginine to citrulline and ammonia. Low concentrations of ADI have been shown to inhibit proliferation in certain cultured cells by arresting the cell cycle in G (1) and/or S phase. Higher concentrations of ADI lead to subsequent apoptosis.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.03% Sodium phosphate, 0.003% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in water to a concentration of 0.1-1.0 mg/ml.

General Info

  • Alternative names
    • AD
    • ADI
    • Arginine deiminase
    • Arginine dihydrolase
    • EC=3.5.3.6
    see all
  • Relevance
    Amino-acid degradation; L-arginine degradation via ADI pathway; carbamoyl phosphate from L-arginine: step 1/2.
  • Cellular localization
    Cytoplasmic

References

ab119147 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for your enquiry.

Reviewing the details for ab119147 Active Arginine deiminase full length protein, the datasheet gives a range between 100-150 ng/ml for induction of apoptosis in Jurkat cells. If you are determining the activity usi...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up