Recombinant BK polyomavirus, strain AS, Major Capsid VP1 protein (ab74567)

Overview

  • Product nameRecombinant BK polyomavirus, strain AS, Major Capsid VP1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SequenceMAPTKRKGECPGAAPKKPKEPVQVPKLLIKGGVEVLEVKTGVDAITEVEC FLNPEMGDPDDNLRGYSQHLSAENAFESDSPD RKMLPCYSTARIPLPN LNEDLTCGNLLMWEAVTVKTEVIGITSMLNLHAGSQKVHENGGGKPVQGS NFHFFAVGGDPLEMQG VLMNYRTKYPQGTITPKNPTAQSQVMNTDHKA YLDKNNAYPVECWIPDPSRNENTRYFGTYTGGENVPPVLHVTNTATTVLL DEQGVGPLCKADSLYVSAADICGLFTNSSGTQQWRGLARYFKIRLRKR SVKNPYPISFLLSDLINRRTQKVDGQPMYGMESQ VEEVRVFDGTEQLP GDPDMIRYIDRQGQLQTKMV

Specifications

Our Abpromise guarantee covers the use of ab74567 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Purity> 90 % by SDS-PAGE.
    Purified by ultracentifugation.
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    Preservative: None
    Constituents: PBS

  • ReconstitutionReconstitute with deionized H20. After reconstitution store at 4°C.

General Info

  • Alternative names
    • Capsid protein VP1
  • RelevanceBK polyomavirus was first isolated in 1971 in the urine of a renal transplant patient, initials B.K. BK polyomavirus, Major Capsid VP1 forms the icosaedric capsid of the virus protecting the viral genome. This capsid is composed of 360 VP1, assembled in 72 pentamers. Each pentamer are linked via the C-terminal end of VP1.
  • Cellular localizationVirion. Nucleus

Recombinant BK polyomavirus, strain AS, Major Capsid VP1 protein images

  • SDS-PAGE showing ab74567 at approximately 44kDa (3.2µg/lane).
    Lane 1 shows the molecular weight ladder. From the bottom: 14.4, 18.4, 25.0, 35.0, 45.0, 66.2, 116.0 kDa.

References for Recombinant BK polyomavirus, strain AS, Major Capsid VP1 protein (ab74567)

ab74567 has not yet been referenced specifically in any publications.

Product Wall

Vielen Dank für Ihre Anfrage.

Meiner Meinung nach sollte das Signal mit diesem sekundären Antikörper stark genug sein wenn Sie polyklonale anti BK polyomavirus -Antikörper in Ihren Proben haben.

Allerdings mö...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"