Recombinant Chicken IL6 protein (ab107958)

Overview

Description

  • NatureRecombinant
  • SourceYeast
  • Amino Acid Sequence
    • AccessionQ90YI0
    • SpeciesChicken
    • SequenceVPLPAAADSSGEVGLEEEAGARRALLDCEPLARVLRDRAVQLQDEMCKKF TVCENSMEMLVRNNLNLPKVTEEDGCLLAGFDEEKCLTKLSSGLFAFQTY LEFIQETFDSEKQNVESLCYSTKHLAATIRQMVINPDEVVIPDSAAQKSL LANLKSDKDWIEKITMHLILRDFTSFMEKTVRAVRYLKKTRSFSA
    • Molecular weight22 kDa
    • Amino acids47 to 241

Associated products

Specifications

Our Abpromise guarantee covers the use of ab107958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab107958 is purified by Ion-exchange chromatography.
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Stable for 12 months at -20°C.

    Preservative: None
    Constituents: 10% Trehalose, 1X PBS

  • ReconstitutionReconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein. Reconstituted protein is stable for at least 3 months when stored in working aliquots with a carrier protein at -20°C. Avoid repeated freeze/thaw cycles.

General Info

  • Alternative names
    • Interleukin BSF 2
    • B cell differentiation factor
    • B cell stimulatory factor 2
    • B-cell stimulatory factor 2
    • BSF 2
    • BSF-2
    • BSF2
    • CDF
    • CTL differentiation factor
    • Hepatocyte stimulatory factor
    • HGF
    • HSF
    • Hybridoma growth factor
    • Hybridoma growth factor Interferon beta-2
    • IFN-beta-2
    • IFNB2
    • IL 6
    • IL-6
    • IL6
    • IL6_HUMAN
    • Interferon beta 2
    • Interferon beta-2
    • Interleukin 6
    • Interleukin 6 (interferon beta 2)
    • Interleukin BSF 2
    • Interleukin-6
    see all
  • FunctionCytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance.
  • Involvement in diseaseGenetic variations in IL6 are associated with susceptibility to rheumatoid arthritis systemic juvenile (RASJ) [MIM:604302]. An inflammatory articular disorder with systemic-onset beginning before the age of 16. It represents a subgroup of juvenile arthritis associated with severe extraarticular features and occasionally fatal complications. During active phases of the disorder, patients display a typical daily spiking fever, an evanescent macular rash, lymphadenopathy, hepatosplenomegaly, serositis, myalgia and arthritis.
    Note=A IL6 promoter polymorphism is associated with a lifetime risk of development of Kaposi sarcoma in HIV-infected men.
  • Sequence similaritiesBelongs to the IL-6 superfamily.
  • Post-translational
    modifications
    N- and O-glycosylated.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant Chicken IL6 protein (ab107958)

ab107958 has not yet been referenced specifically in any publications.

Product Wall

Thanks for your call yesterday and for your patience while I have been in touch with the lab. I've heard back from my contact at the lab, and she has replied: "The vial can hold up to 0.5 ml, but I would recommend reconstitution in 100 µl of PBS + 0.1%...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"