Recombinant Dengue virus 1 NS1 protein (ab181950)

Overview

  • Product name
    Recombinant Dengue virus 1 NS1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Sequence
      DSGCVINWKGRELKCGSGIFVTNEVHTWTEQYKFQADSPKRLSAAIGKAW EEGVCGIRSATRLENIMWKQISNELNHILLENDMKFTVVVGDVSGILAQG KKMIRPQPMEHKYSWKSWGKAKIIGADVQNTTFIIDGPNTPECPDNQRAW NIWEVEDYGFGIFTTNIWLKLRDSYTQVCDHRLMSAAIKDSKAVHADMGY WIESEKNETWKLARASFIEVKTCIWPKSHTLWSNGVLESEMIIPKIYGGP ISQHNYRPGYFTQTAGPWHLGKLELDFDLCEGTTVVVDEHCGNRGPSLRT TTVTGKTIHEWCCRSCTLPPLRFKGEDGCWYGMEIRPVKEKEENLVKSMV SA
    • Molecular weight
      40 kDa
    • Amino acids
      776 to 1127
    • Additional sequence information
      Strain: Nauru/Western Pacific/1974

Specifications

Our Abpromise guarantee covers the use of ab181950 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab181950 is 0.2µm filter sterilised.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

References

ab181950 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

The DENV NS1 protein products are all full length mammalian recombinants produced in a human cell line. They are hexameric in conformation as demonstrated by a single sharp peak at around 440kDa via SEC. They are correctly glycosylated due to the fact ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up