Recombinant Dog Lipocalin-2 / NGAL protein (ab188060)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Dog
    • Sequence
      MTQVLLWLGLALLGSLQVQTQDSTPSLIPAPPPLKVPLQPDFQHDQFQGK WYVIGIAGNILKKEGHGQLKMYTTTYELKDDQSYNVTSTLLRNERCDYWN RDFVPSFQPGQFSLGDIQLYPGVQSYLVQVVATNYNQYALVYFRKVYKSQ EYFKITLYGRTKELPLELKKEFIRFAKSIGLTEDHIIFPVPIDQCIDE
    • Molecular weight
      23 kDa

Specifications

Our Abpromise guarantee covers the use of ab188060 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    pH: 7.40
    Preservative: 0.1% Proclin
    Constituents: 0.81% Sodium chloride, 0.5% BSA, 0.5% Tween, 0.0016% Phenol red, 98% PBS

General Info

  • Alternative names
    • 24p3
    • 25 kDa alpha-2-microglobulin-related subunit of MMP-9
    • HNL
    • Lcn2
    • Lipocalin 2
    • Lipocalin-2
    • Migration stimulating factor inhibitor
    • MSFI
    • Neutrophil gelatinase-associated lipocalin
    • NGAL
    • NGAL_HUMAN
    • Oncogene 24p3
    • p25
    • Siderocalin
    • Siderocalin LCN2
    see all
  • Function
    Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. Binds iron through association with 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. Involved in innate immunity, possibly by sequestrating iron, leading to limit bacterial growth.
  • Tissue specificity
    Expressed in bone marrow and in tissues that are prone to exposure to microorganism. High expression is found in bone marrow as well as in uterus, prostate, salivary gland, stomach, appendix, colon, trachea and lung. Not found in the small intestine or peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the calycin superfamily. Lipocalin family.
  • Cellular localization
    Secreted. Upon binding to the SLC22A17 (24p3R) receptor, it is internalized.
  • Information by UniProt

Images

  • ELISA calibration curve using ab188060 as a standard.

References

ab188060 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188060.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up