Recombinant E. coli cysH protein (ab106888)

Overview

  • Product name
    Recombinant E. coli cysH protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSKLDLNALNELPKVDRILALAETNAELEK LDAEGRVAWALDNLPGEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTG YLFPETYRFIDELTDKLKLNLKVYRATESAAWQEARYGKLWEQGVEGIEK YNDINKVEPMNRALKELNAQTWFAGLRREQSGSRANLPVLAIQRGVFKVL PIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVGDTHTTRKWEPGMAEEET RFFGLKRECGLHEG
    • Molecular weight
      30 kDa including tags
    • Amino acids
      1 to 244
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab106888 was purified using conventional chromatography techniques
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 3' phosphoadenosine 5' phosphosulfate reductase
    • ECK2757
    • JW2732
  • Relevance
    CysH (Phosphoadenosine phosphosulfate reductase) belongs to the PAPS reductase family, specifically those acting on a sulfur group of donors with a disulfide as acceptor. Three substrates of this enzyme are adenosine 3',5'-bisphosphate, sulfite, and thioredoxin disulfide, whereas its two products are 3'-phosphoadenylyl sulfate and thioredoxin.
  • Cellular localization
    Cytoplasm

Recombinant E. coli cysH protein images

  • 15% SDS-PAGE analysis of 3 µg ab106888.

References for Recombinant E. coli cysH protein (ab106888)

ab106888 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up