Recombinant E. coli deoC protein (ab106864)

Overview

  • Product name
    Recombinant E. coli deoC protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTDLKASSLRALKLMDLTTLNDDDTDEKVI ALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGN DDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACA AANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPE SARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADA RHYRFGASSLLASLLKALGHGDGKSASSY
    • Molecular weight
      30 kDa including tags
    • Amino acids
      1 to 259
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab106864 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • 2 deoxyribose 5 phosphate aldolase
    • 2 deoxyribose 5 phosphate aldolase NAD(P) linked
    • 2-deoxy-D-ribose 5-phosphate aldolase
    • deoC
    • DEOC_ECOLI
    • Deoxyriboaldolase
    • Deoxyribose-phosphate aldolase
    • DERA
    • dra
    • Phosphodeoxyriboaldolase
    • thyR
    see all
  • Function
    Catalyzes a reversible aldol reaction between acetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5-phosphate.
  • Pathway
    Carbohydrate degradation; 2-deoxy-D-ribose 1-phosphate degradation; D-glyceraldehyde 3-phosphate and acetaldehyde from 2-deoxy-alpha-D-ribose 1-phosphate: step 2/2.
  • Sequence similarities
    Belongs to the DeoC/FbaB aldolase family. DeoC type 2 subfamily.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab106864.

References

ab106864 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab106864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up