Recombinant E. coli deoC protein (ab106864)

Overview

  • Product name
    Recombinant E. coli deoC protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTDLKASSLRALKLMDLTTLNDDDTDEKVI ALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGN DDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACA AANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPE SARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADA RHYRFGASSLLASLLKALGHGDGKSASSY
    • Molecular weight
      30 kDa including tags
    • Amino acids
      1 to 259
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab106864 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • 2 deoxyribose 5 phosphate aldolase
    • 2 deoxyribose 5 phosphate aldolase NAD(P) linked
    • 2-deoxy-D-ribose 5-phosphate aldolase
    • deoC
    • DEOC_ECOLI
    • Deoxyriboaldolase
    • Deoxyribose-phosphate aldolase
    • DERA
    • dra
    • Phosphodeoxyriboaldolase
    • thyR
    see all
  • Function
    Catalyzes a reversible aldol reaction between acetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5-phosphate.
  • Pathway
    Carbohydrate degradation; 2-deoxy-D-ribose 1-phosphate degradation; D-glyceraldehyde 3-phosphate and acetaldehyde from 2-deoxy-alpha-D-ribose 1-phosphate: step 2/2.
  • Sequence similarities
    Belongs to the DeoC/FbaB aldolase family. DeoC type 2 subfamily.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant E. coli deoC protein images

  • 15% SDS-PAGE analysis of 3µg ab106864.

References for Recombinant E. coli deoC protein (ab106864)

ab106864 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up