Recombinant E. coli E. coli serine protease inhibitor protein (ab151888)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MKTILPAVLFAAFATTSAWAAESVQPLEKIAPYPQAEKGMKRQVIQLTPQ EDESTLKVEL LIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVS SPVSTMMACPDGKKEKKFVTAY LGDAGMLRYNSKLPIVVYTPDNVDVK YRVWKAEEKIDNAVVR
    • Molecular weight
      18 kDa
    • Amino acids
      1 to 162

Specifications

Our Abpromise guarantee covers the use of ab151888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab151888 has greater than 95% purity as determined by SEC-HPLC and reducing SDS-PAGE. Lyophilized from a 0.2 µM filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.50
    Constituents: 0.32% Tris HCl, 1.75% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • ECK2201
    • Ecotin
    • Ecotin, a serine protease inhibitor
    • eti
    • JW2197
    see all
  • Relevance
    E. coli serine protease inhibitor (Ecotin) inhibits pancreatic serine proteases: inhibits chymotrypsin, trypsin, elastases, factor X, kallikrein as well as a variety of other proteases. The strength of inhibition does not appear to be correlated with a particular protease specificity.
  • Cellular localization
    Periplasm.

References

ab151888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up