Recombinant E. coli fimC protein (ab104677)

Overview

  • Product nameRecombinant E. coli fimC protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP31697
    • SpeciesEscherichia coli
    • SequenceMGSSHHHHHHSSGLVPRGSHMGVALGATRVIYPAGQKQEQLAVTNNDENS TYLIQSWVENADGVKDGRFIVTPPLFAMKGKKENTLRILDATNNQLPQDR ESLFWMNVKAIPSMDKSKLTENTLQLAIISRIKLYYRPAKLALPPDQAAE KLRFRRSANSLTLINPTPYYLTVTELNAGTRVLENALVPPMGESTVKLPS DAGSNITYRTINDYGALTPKMTGVME
    • Molecular weight25 kDa including tags
    • Amino acids37 to 241
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104677 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab104677 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Chaperone periplasmic
    • Chaperone protein fimC
    • ECK4307
    • JW4279
    • Periplasmic chaperone required for type 1 fimbriae
    see all
  • RelevanceFimC is a member of the periplasmic chaperone family which functions in the chaperone-usher pathway and is indispensable in the biogenesis of the type 1 pilus fiber of Escherichia coli. It binds and interacts with fimH.
  • Cellular localizationPeriplasm

Recombinant E. coli fimC protein images

  • 15% SDS-PAGE analysis of 3µg ab104677.

References for Recombinant E. coli fimC protein (ab104677)

ab104677 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104677.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"