Recombinant E. coli fimC protein (ab104677)

Overview

  • Product name
    Recombinant E. coli fimC protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGVALGATRVIYPAGQKQEQLAVTNNDENS TYLIQSWVENADGVKDGRFIVTPPLFAMKGKKENTLRILDATNNQLPQDR ESLFWMNVKAIPSMDKSKLTENTLQLAIISRIKLYYRPAKLALPPDQAAE KLRFRRSANSLTLINPTPYYLTVTELNAGTRVLENALVPPMGESTVKLPS DAGSNITYRTINDYGALTPKMTGVME
    • Molecular weight
      25 kDa including tags
    • Amino acids
      37 to 241
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104677 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab104677 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Chaperone periplasmic
    • Chaperone protein fimC
    • ECK4307
    • JW4279
    • Periplasmic chaperone required for type 1 fimbriae
    see all
  • Relevance
    FimC is a member of the periplasmic chaperone family which functions in the chaperone-usher pathway and is indispensable in the biogenesis of the type 1 pilus fiber of Escherichia coli. It binds and interacts with fimH.
  • Cellular localization
    Periplasm

Recombinant E. coli fimC protein images

  • 15% SDS-PAGE analysis of 3µg ab104677.

References for Recombinant E. coli fimC protein (ab104677)

ab104677 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104677.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up