Recombinant E. coli fimC protein (ab104677)

Overview

  • Product name
    Recombinant E. coli fimC protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGVALGATRVIYPAGQKQEQLAVTNNDENS TYLIQSWVENADGVKDGRFIVTPPLFAMKGKKENTLRILDATNNQLPQDR ESLFWMNVKAIPSMDKSKLTENTLQLAIISRIKLYYRPAKLALPPDQAAE KLRFRRSANSLTLINPTPYYLTVTELNAGTRVLENALVPPMGESTVKLPS DAGSNITYRTINDYGALTPKMTGVME
    • Molecular weight
      25 kDa including tags
    • Amino acids
      37 to 241
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104677 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab104677 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Chaperone periplasmic
    • Chaperone protein fimC
    • ECK4307
    • JW4279
    • Periplasmic chaperone required for type 1 fimbriae
    see all
  • Relevance
    FimC is a member of the periplasmic chaperone family which functions in the chaperone-usher pathway and is indispensable in the biogenesis of the type 1 pilus fiber of Escherichia coli. It binds and interacts with fimH.
  • Cellular localization
    Periplasm

Images

  • 15% SDS-PAGE analysis of 3µg ab104677.

References

ab104677 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104677.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up