Recombinant E. coli glsA1 protein (ab107143)

Overview

  • Product name
    Recombinant E. coli glsA1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDG NVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNS VIALELHGGKPLSPLVNAGAIATTSLINAENVEQRWQRILHIQQQLAGEQ VALSDEVNQSEQTTNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLL NTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMMEGLYGRSGDW AYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVA KQLGYNVFKG
    • Molecular weight
      35 kDa including tags
    • Amino acids
      1 to 310
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107143 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    Purified by using conventional chromatography techniques
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • ECK0479
    • glsA1
    • GLSA1_ECOLI
    • Glutaminase
    • Glutaminase 1
    • JW0474
    • Putative glutaminase
    see all
  • Sequence similarities
    Belongs to the glutaminase family.
  • Information by UniProt

Recombinant E. coli glsA1 protein images

  • ab107143 at 3 µg analysed by 15% SDS PAGE.

References for Recombinant E. coli glsA1 protein (ab107143)

ab107143 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107143.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up