Recombinant E. coli glsA1 protein (ab107143)

Overview

  • Product name
    Recombinant E. coli glsA1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDG NVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNS VIALELHGGKPLSPLVNAGAIATTSLINAENVEQRWQRILHIQQQLAGEQ VALSDEVNQSEQTTNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLL NTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMMEGLYGRSGDW AYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVA KQLGYNVFKG
    • Molecular weight
      35 kDa including tags
    • Amino acids
      1 to 310
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107143 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    Purified by using conventional chromatography techniques
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • ECK0479
    • glsA1
    • GLSA1_ECOLI
    • Glutaminase
    • Glutaminase 1
    • JW0474
    • Putative glutaminase
    see all
  • Sequence similarities
    Belongs to the glutaminase family.
  • Information by UniProt

Images

  • ab107143 at 3 µg analysed by 15% SDS PAGE.

References

ab107143 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107143.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up